close all open/close all

CDS information : Vanco_00120


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction37,258 / 38,433 / + [in whole cluster]
37,258 / 38,433 / + [in contig]
Location37258..38433 [in whole cluster]
37258..38433 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450 monooxygenase A
Gene
Gene (GenBank)oxyA
EC number
Keyword
  • 2nd cross-linking
  • D-O-E ring
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q8RN05
PmId
[12207020] Crystal structure of OxyB, a cytochrome P450 implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis. (J Biol Chem. , 2002)
ACC
O87673
NITE
Balhi_00110
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
[11353482] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-New Insights into the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323). We thank M. Schierle, Dr. S. Stevanovic and Prof. H.-G. Rammensee for help with Edman degradation and J. Turner, Prof. B. List and Prof. D. Boger (La Jolla, USA) for discussions on the work. (Angew Chem Int Ed Engl. , 2001)
[12404385] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-The Order of the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323) and by a grant of the EU (MEGATOP, QLK3-1999-00650). R. D. S. gratefully acknowledges the support of a Feodor-Lynen Fellowship granted by the Alexander-von-Humboldt Stiftung. We thank Corina Bihlmaier and Volker Pfeifer for help with transformation and Southern hybridization, J. A. Moss (La Jolla (USA)) for critical comments on the manuscript and Prof. Dr. M. E. Maier and Prof. Dr. H.-P. Fiedler (Tubingen) for generous support. (Angew Chem Int Ed Engl. , 2001)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[16730832] Genetic analysis of the balhimycin (vancomycin-type) oxygenase genes. (J Biotechnol. , 2006)
ACC
R4SMY3
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 monooxygenase A]
MFEEKNALRGTEIHRRERFDPGPELRALMAEGRMSVMESEESPGGRTGWLATGYEETRQV
LGSDKFSAKLLFGGTAAGRIWPGFLNQYDPPEHTRLRRMVASAFTVRRMRDFRPRIEAVV
KATLDDIEATGGPVDFVPRFAWPIATTVICDFLGIPRDDQAELSRVLHASRSERSGKRRV
AAGNKYWTYMGQVAAKTRRDPGDDMFGAVVREHGDDITDAELLGVAAFVMGASGDQVARF
LSAGAWLMVEHPEQFAVLRDDPDSVPDWLNEVARYLTSDEKTTPRIALEDVRIGDQLVKK
GDAVTCSLLASNRHRFPDPEDRFDITREKPSHVTFGHGIHHCLGRPLAEMVFRTAIPALA
HRFPTLRLAEPDREIKLGPPPFDVEALLLDW
selected fasta
>putative cytochrome P450 [P450 monooxygenase A]
GTGTTCGAGGAGAAGAACGCCCTCCGGGGAACGGAAATCCACCGGAGAGAGCGGTTCGAC
CCGGGACCGGAGCTGCGTGCGCTGATGGCCGAAGGCCGCATGTCCGTGATGGAGTCGGAA
GAGTCCCCGGGCGGGCGTACCGGGTGGCTCGCCACCGGGTACGAGGAGACCCGCCAGGTG
CTCGGCTCGGACAAGTTCAGCGCCAAGCTGCTGTTCGGCGGGACGGCGGCGGGCCGCATC
TGGCCCGGGTTCCTCAACCAGTACGACCCGCCGGAGCACACGCGCCTGCGCCGGATGGTG
GCCTCCGCGTTCACCGTCCGGCGGATGCGGGATTTCCGGCCGCGGATCGAGGCGGTCGTC
AAGGCCACCCTGGACGACATCGAGGCCACCGGCGGGCCGGTGGATTTCGTGCCCCGGTTC
GCGTGGCCCATCGCGACGACGGTGATCTGCGACTTCCTCGGCATTCCCCGTGACGATCAG
GCGGAGCTGTCGCGCGTCCTGCACGCCAGCCGGTCCGAACGGTCGGGCAAACGGCGGGTG
GCGGCGGGGAACAAGTACTGGACGTACATGGGCCAGGTCGCGGCCAAAACGCGTCGCGAT
CCCGGTGACGACATGTTCGGTGCCGTGGTGCGCGAACACGGCGACGACATCACCGACGCG
GAACTGCTGGGCGTCGCCGCGTTCGTGATGGGCGCCAGCGGGGATCAGGTGGCGCGGTTC
CTCTCGGCGGGTGCGTGGCTGATGGTCGAGCACCCCGAGCAGTTCGCCGTGCTGCGCGAC
GACCCGGACAGCGTCCCGGATTGGCTGAACGAGGTGGCCCGCTACCTCACCAGCGACGAG
AAGACCACTCCGCGCATCGCGCTGGAGGACGTGCGGATCGGTGACCAGCTCGTCAAGAAG
GGCGATGCCGTCACCTGTTCCCTGCTGGCTTCGAACCGGCACAGGTTCCCCGACCCGGAG
GACCGGTTCGACATCACCCGGGAAAAGCCCTCGCATGTCACGTTCGGGCACGGTATCCAT
CACTGCCTCGGCCGTCCGCTGGCGGAAATGGTGTTCCGGACGGCGATTCCGGCGCTGGCG
CACCGGTTTCCCACGCTCAGGCTGGCCGAACCGGATCGCGAGATCAAACTGGGCCCGCCG
CCGTTCGACGTGGAAGCCCTGCTGCTCGACTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [15-382]  1.2e-81 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [269-363]  1.2e-10 PF00067
PF00067   p450
 [15-391]  2e-73 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  8.7e-37 PR00359 [135-151]  8.7e-37 PR00359 [152-167]  8.7e-37 PR00359 [188-210]  8.7e-37 PR00359 [267-278]  8.7e-37 PR00359 [285-312]  8.7e-37 PR00359 [333-342]  8.7e-37 PR00359 [342-353]  8.7e-37 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [335-344]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit