close all open/close all

CDS information : Vanco_00130


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction38,837 / 40,033 / + [in whole cluster]
38,837 / 40,033 / + [in contig]
Location38837..40033 [in whole cluster]
38837..40033 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase B
Gene
Gene (GenBank)oxyB
EC number
Keyword
  • 1st cross-linking
  • C-O-D ring
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q8RN04
PmId
[12207020] Crystal structure of OxyB, a cytochrome P450 implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis. (J Biol Chem. , 2002)
[15593150] An oxidative phenol coupling reaction catalyzed by oxyB, a cytochrome P450 from the vancomycin-producing microorganism. (Angew Chem Int Ed Engl. , 2004)
[17477533] Oxidative phenol coupling reactions catalyzed by OxyB: a cytochrome P450 from the vancomycin producing organism. implications for vancomycin biosynthesis. (J Am Chem Soc. , 2007)
[18068978] New insights into the first oxidative phenol coupling reaction during vancomycin biosynthesis. (Bioorg Med Chem Lett. , 2008)
[18688478] Exploring the substrate specificity of OxyB, a phenol coupling P450 enzyme involved in vancomycin biosynthesis. (Org Biomol Chem. , 2008)
[20337711] Genome mining in Amycolatopsis balhimycina for ferredoxins capable of supporting cytochrome P450 enzymes involved in glycopeptide antibiotic biosynthesis. (FEMS Microbiol Lett. , 2010)
[23073849] Substituent effects on the phenol coupling reaction catalyzed by the vancomycin biosynthetic P450 enzyme OxyB. (Angew Chem Int Ed Engl. , 2012)
ACC
R4SV88
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase B]
MSEDDPRPLHIRRQGLDPADELLAAGALTRVTIGSGADAETHWMATAHAVVRQVMGDHQQ
FSTRRRWDPRDEIGGKGIFRPRELVGNLMDYDPPEHTRLRRKLTPGFTLRKMQRMAPYIE
QIVNDRLDEMERAGSPADLIAFVADKVPGAVLCELVGVPRDDRDMFMKLCHGHLDASLSQ
KRRAALGDKFSRYLLAMIARERKEPGEGMIGAVVAEYGDDATDEELRGFCVQVMLAGDDN
ISGMIGLGVLAMLRHPEQIDAFRGDEQSAQRAVDELIRYLTVPYSPTPRIAREDLTLAGQ
EIKKGDSVICSLPAANRDPALAPDVDRLDVTREPIPHVAFGHGVHHCLGAALARLELRTV
FTELWRRFPALRLADPAQDTEFRLTTPAYGLTELMVAW
selected fasta
>cytochrome P450 [P450 monooxygenase B]
TTGAGCGAGGACGACCCGCGCCCGCTGCACATTCGCAGGCAGGGCTTGGATCCGGCGGAC
GAACTGCTCGCCGCCGGAGCGCTGACGAGGGTCACCATCGGATCCGGAGCGGACGCCGAG
ACCCATTGGATGGCCACCGCGCACGCCGTCGTCCGGCAGGTGATGGGTGATCACCAGCAG
TTCAGCACCCGGCGCCGCTGGGACCCGCGGGACGAGATCGGCGGGAAGGGCATCTTCCGG
CCGCGGGAACTGGTCGGCAACCTGATGGACTACGACCCGCCCGAGCACACGCGGCTGCGG
CGGAAACTGACGCCCGGCTTCACCCTGCGGAAAATGCAGCGGATGGCGCCGTACATCGAG
CAGATCGTGAACGACCGCCTCGACGAGATGGAGCGGGCGGGATCCCCCGCGGATCTGATC
GCGTTCGTCGCCGACAAGGTGCCCGGCGCCGTGCTGTGCGAGCTGGTCGGGGTGCCGAGG
GACGACCGCGACATGTTCATGAAGCTCTGTCACGGGCATCTCGACGCCTCGCTGAGTCAA
AAGCGCCGGGCGGCGCTCGGCGACAAGTTCTCGCGCTATCTGCTGGCGATGATCGCCAGG
GAACGCAAGGAGCCGGGTGAGGGGATGATCGGCGCGGTCGTCGCCGAATACGGGGACGAC
GCCACGGACGAGGAGCTACGCGGTTTCTGCGTTCAGGTGATGCTGGCGGGCGACGACAAC
ATCTCCGGCATGATCGGCCTCGGTGTGCTGGCGATGCTGCGCCATCCCGAGCAGATCGAC
GCTTTCCGCGGCGACGAGCAGTCGGCGCAACGGGCGGTCGACGAGCTGATCCGGTACCTG
ACCGTGCCGTACAGCCCGACTCCCCGGATCGCCAGGGAGGACCTCACCCTCGCGGGGCAG
GAGATCAAGAAGGGGGACAGCGTCATCTGCTCGCTCCCCGCGGCCAACCGTGATCCCGCG
CTGGCACCGGATGTGGACCGCCTCGACGTCACCCGCGAGCCCATCCCGCATGTCGCCTTC
GGGCACGGAGTCCACCATTGCCTCGGCGCCGCGCTGGCCCGGCTCGAACTGCGCACGGTC
TTCACCGAGCTGTGGCGGCGTTTCCCGGCGCTGAGGCTCGCGGATCCCGCACAGGACACC
GAATTCCGGCTGACCACTCCCGCGTACGGATTGACCGAGCTGATGGTCGCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [38-398]  2.4e-88 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [5-398]  1.8e-86 SSF48264
SSF48264   Cytochrome P450
 [216-369]  1.3e-14 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  1.5e-52 PR00359 [138-154]  1.5e-52 PR00359 [155-170]  1.5e-52 PR00359 [192-214]  1.5e-52 PR00359 [271-282]  1.5e-52 PR00359 [289-316]  1.5e-52 PR00359 [317-332]  1.5e-52 PR00359 [338-347]  1.5e-52 PR00359 [347-358]  1.5e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit