close all open/close all

CDS information : Vanco_00150


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction41,427 / 42,902 / + [in whole cluster]
41,427 / 42,902 / + [in contig]
Location41427..42902 [in whole cluster]
41427..42902 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Producthalogenase
Product (GenBank)vancomycin halogenase A
Gene
Gene (GenBank)vhaA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[24756572] Bis-chlorination of a hexapeptide-PCP conjugate by the halogenase involved in vancomycin biosynthesis. (Org Biomol Chem. , 2014)
Related Reference
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
ACC
R4T052
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>halogenase [vancomycin halogenase A]
MSVEDFDVVVAGGGPGGSTVATLVAMQGHRVLLLEKEVFPRYQIGESLLPATVHGVCRML
GVADELAGAGFPIKRGGTFRWGARPEPWTFHFGISAKMAGSTSHAYQVERARFDEILLNN
AKSKGVVVREGCSVHDVVEDGERVTGAKYTDPDGNEREVSARFVIDASGNKSRLYSKVGG
SRNYSEFFRSLALFGYFEGGKRLPEPVSGNILSVAFDNGWFWYIPLSDTLTSVGAVVRRE
DADKIQGDREKALNALIAECPLISEYLSNATRVTTGKYGELRVRKDYSYQQETYWRPGMV
LVGDAACFVDPVFSSGVHLATYSALLAARSINSVLAGDLDEKTALNEFEARYRREYGVFY
EFLVSFYQMNVNEESYFWQAKKVTQNQSTDIESFVELIGGVSSGETALTAADRIAARSAE
FAAAVDEMAGGDGDNMVPMFKSTVVKQAMQEAGQVQMKALLGEDAEPELPLFPGGLVTSP
DGMKWLPHHPA
selected fasta
>halogenase [vancomycin halogenase A]
ATGTCGGTCGAAGATTTCGATGTGGTGGTTGCCGGTGGCGGGCCGGGTGGTTCGACCGTG
GCCACACTGGTCGCGATGCAGGGCCATCGGGTGCTGTTGCTGGAGAAGGAGGTCTTTCCC
CGGTACCAGATCGGTGAATCGCTGCTGCCCGCCACGGTGCACGGCGTGTGCCGGATGCTC
GGCGTCGCCGACGAGCTGGCGGGGGCGGGGTTCCCGATCAAGCGGGGCGGCACGTTCCGC
TGGGGTGCCCGGCCGGAGCCGTGGACATTCCACTTCGGCATCTCCGCCAAGATGGCCGGC
TCGACGTCGCACGCCTACCAGGTCGAGCGGGCGCGGTTCGACGAGATCCTGCTGAACAAC
GCCAAAAGCAAGGGCGTCGTCGTGCGGGAAGGCTGCTCTGTCCACGATGTGGTGGAAGAC
GGTGAGCGGGTCACCGGCGCGAAGTACACCGACCCCGACGGCAACGAGCGTGAGGTGTCG
GCGCGTTTCGTGATCGACGCGTCGGGCAACAAGAGCCGCCTCTATTCCAAGGTCGGCGGT
TCACGGAACTACTCGGAGTTCTTCCGCAGCCTCGCGTTGTTCGGCTACTTCGAGGGCGGC
AAGCGGCTGCCGGAGCCGGTGTCGGGGAACATCCTGAGCGTGGCCTTCGACAACGGCTGG
TTCTGGTACATCCCGTTGAGCGACACGCTCACCAGTGTCGGCGCGGTGGTGCGCCGGGAG
GACGCCGACAAGATCCAGGGTGACCGCGAGAAGGCCCTCAACGCCTTGATCGCCGAATGC
CCGCTGATCTCGGAATACCTCTCGAACGCGACCAGGGTGACGACCGGCAAGTACGGGGAA
CTGCGTGTCCGCAAGGACTATTCGTACCAGCAGGAGACCTACTGGCGGCCGGGCATGGTC
CTGGTCGGCGACGCCGCGTGCTTCGTGGACCCGGTGTTCTCCTCCGGGGTGCACCTGGCG
ACCTACAGCGCGCTGCTCGCGGCCCGGTCGATCAACAGCGTCCTCGCCGGCGATCTCGAC
GAGAAGACCGCGCTGAACGAGTTCGAAGCGCGGTATCGCCGGGAATACGGCGTCTTCTAC
GAATTCCTCGTTTCCTTCTATCAGATGAACGTCAACGAGGAGTCGTACTTCTGGCAGGCC
AAGAAGGTCACCCAGAACCAGAGCACCGACATCGAGTCGTTCGTCGAACTGATCGGCGGG
GTGTCCTCGGGGGAGACCGCGCTGACGGCCGCCGACCGGATCGCCGCGCGCAGTGCCGAA
TTCGCCGCCGCGGTGGACGAGATGGCCGGTGGCGACGGGGACAACATGGTGCCGATGTTC
AAGTCGACGGTCGTCAAGCAGGCGATGCAGGAGGCGGGCCAGGTCCAGATGAAGGCGCTG
CTCGGCGAGGACGCCGAACCCGAGCTGCCGCTGTTCCCCGGCGGACTGGTGACTTCGCCC
GACGGCATGAAGTGGCTGCCGCACCACCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.6999992228405e-07 PR00420 [160-175]  1.6999992228405e-07 PR00420 [296-311]  1.6999992228405e-07 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [7-95]  7.7e-23 PF04820 [99-402]  8.10000000000001e-76 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit