close all open/close all

CDS information : Vanco_00170


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction44,225 / 45,457 / + [in whole cluster]
44,225 / 45,457 / + [in contig]
Location44225..45457 [in whole cluster]
44225..45457 [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase E
Gene
Gene (GenBank)gtfE
EC number2.4.1.310
Keyword
  • D-glucose
  • Hpg4
Note
  • This ORF product can also catalyze a reversible reaction.
Note (GenBank)
Reference
ACC
PmId
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[12498883] Incorporation of glucose analogs by GtfE and GtfD from the vancomycin biosynthetic pathway to generate variant glycopeptides. (Chem Biol. , 2002)
[16946071] Exploiting the reversibility of natural product glycosyltransferase-catalyzed reactions. (Science. , 2006)
[24954524] Enzymatic glycosylation of vancomycin aglycon: completion of a total synthesis of vancomycin and N- and C-terminus substituent effects of the aglycon substrate. (Org Lett. , 2014)
Related Reference
ACC
P96565
PmId
[9115410] Production of hybrid glycopeptide antibiotics in vitro and in Streptomyces toyocaensis. (Chem Biol. , 1997)
ACC
R4SMY8
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase E]
MMRVLLATCGSRGDVEPLVALAVRLRARGAEVRMCAPPDCADRLAEVGVPHLPLGRSARP
AAAGEAKPLTAEDMLRFTTETIAMQFDRIPAAAEGCDAVVTTGLLAAALGVRSVAEKLGI
PYFYAFHCPSYVPSPYYAPPPPLGEPPAPEGTDIRALWERNNQSAFRRYGAPLNSQRAAI
GLPPVEDIFEHGYTDHPWMAADQVLAPLQPTDLDAVQTGAWILPDERPLSPEMEAFLDAG
TPPVYLGFGSLRAPADAAKVAIEAIRAHGRRVILSRGWADLVLPDDRDDCFATGEVNQQV
LFRRVAAVIHHGGAGTTHVATRAGAPQILVPQIADQPYYAGRVAELGIGVAHDGPTPTFE
SLSAALTTALAPETRVRAEAVAGTVLTDGAAAAADLLFAAVGEEKPAVPA
selected fasta
>glycosyltransferase [glycosyltransferase E]
GTGATGCGTGTGCTGTTGGCGACGTGCGGAAGTCGCGGGGACGTCGAACCCTTGGTGGCG
CTGGCGGTCCGGCTGCGGGCGCGCGGTGCCGAGGTGCGGATGTGCGCGCCGCCGGACTGC
GCGGACCGGCTGGCCGAGGTCGGGGTGCCGCATCTGCCCCTCGGCCGGTCGGCGCGCCCG
GCGGCGGCGGGGGAGGCGAAGCCCTTGACGGCCGAGGACATGCTCCGGTTCACGACCGAG
ACGATCGCCATGCAGTTCGACCGGATCCCGGCGGCCGCCGAGGGGTGCGACGCGGTGGTG
ACGACCGGGCTGCTGGCCGCCGCGCTCGGCGTCCGGTCGGTGGCCGAGAAGCTGGGGATC
CCCTACTTCTACGCCTTCCATTGCCCGAGCTACGTGCCGTCGCCGTACTACGCGCCGCCG
CCGCCACTCGGCGAGCCGCCCGCGCCGGAGGGGACCGACATCCGGGCGTTGTGGGAGCGG
AACAATCAGAGCGCCTTCCGCCGGTACGGGGCCCCGCTCAACAGCCAACGGGCCGCGATC
GGCCTTCCGCCGGTGGAAGACATCTTCGAACACGGCTACACCGATCACCCGTGGATGGCG
GCGGACCAGGTCCTGGCCCCGCTGCAGCCGACGGATCTCGACGCGGTGCAGACCGGCGCG
TGGATCCTCCCCGACGAGCGGCCGCTTTCCCCGGAGATGGAAGCGTTCCTGGACGCCGGG
ACACCGCCGGTCTACCTGGGATTCGGCAGCCTGCGTGCCCCCGCCGACGCCGCGAAGGTG
GCCATCGAGGCGATCCGGGCCCACGGCCGCCGCGTGATCCTCTCCCGTGGCTGGGCCGAT
CTGGTCCTGCCCGACGACCGTGACGACTGTTTCGCCACCGGTGAGGTGAACCAGCAGGTG
CTGTTCCGCCGGGTGGCCGCCGTCATCCACCACGGTGGCGCGGGGACGACGCATGTGGCC
ACGCGGGCGGGCGCACCCCAGATCCTGGTGCCCCAGATCGCGGACCAGCCGTACTACGCC
GGCCGGGTGGCCGAACTCGGGATCGGCGTCGCGCATGACGGCCCGACGCCGACCTTCGAG
TCCCTTTCGGCCGCGCTCACCACGGCCCTCGCGCCGGAAACGCGGGTGCGGGCGGAGGCC
GTGGCGGGCACCGTCCTCACCGACGGGGCGGCGGCTGCCGCGGATCTGTTGTTCGCCGCG
GTCGGCGAGGAGAAGCCCGCCGTTCCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [4-136]  1.5e-30 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit