close all open/close all

CDS information : Vanco_00190


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction46,732 / 47,544 / + [in whole cluster]
46,732 / 47,544 / + [in contig]
Location46732..47544 [in whole cluster]
46732..47544 [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypotetical protein
Gene
Gene (GenBank)ORF113
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
  • This ORF product lacks a metal binding site (histidine residue) required for deacetylase activity.
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52804
NITE
Chlor_00160
PmId
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)
ACC
Q939Y6
NITE
Balhi_00190
PmId
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)
ACC
R4SZ84
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>hypothetical protein [hypotetical protein]
MSQDLHTGRIVAISPHLDDAVLSFGAGLARATRDGAKVTVHTVFAGTAVAPFSPAADRLH
SIWGFSPEQDASLHRRNEDIAALGHLGAEYRHGRFLDAIYRKLPDGRWLADHVPGRQKLA
IGELSPQSDPELFSAVKDDIEAVVEECEPTLILTCGAISGHIDNKIARDATLLVARDKGI
PVRLWEDLPHALFAPDTPELPEGFQLGPPIHASVEPDLRTRKFEALRRYPSQMLMLHGPD
KDLFAQLDGHARKSSAQPGYGELTWPVVSR
selected fasta
>hypothetical protein [hypotetical protein]
ATGTCCCAAGACCTCCACACGGGCCGGATAGTGGCGATCTCCCCGCATCTGGACGACGCG
GTGCTGTCCTTCGGGGCCGGTCTCGCCCGGGCCACGCGGGACGGCGCGAAGGTGACCGTC
CACACGGTGTTCGCCGGTACCGCGGTGGCACCTTTCTCGCCGGCGGCGGACCGGCTGCAT
TCGATCTGGGGCTTCTCCCCGGAGCAGGACGCGTCGCTTCATCGCCGGAACGAGGACATC
GCCGCGCTCGGCCACTTGGGGGCCGAATACCGGCACGGCCGGTTCCTGGACGCCATCTAC
CGCAAACTCCCGGACGGCCGGTGGCTGGCGGACCACGTCCCGGGACGGCAGAAGCTGGCC
ATCGGTGAACTGTCGCCGCAGAGCGATCCGGAGCTGTTCTCCGCGGTCAAGGACGACATC
GAGGCCGTCGTCGAAGAGTGCGAGCCGACGCTGATCCTGACCTGTGGCGCCATCAGCGGT
CACATCGACAACAAGATCGCGCGGGACGCCACGCTGCTCGTCGCGCGGGACAAGGGCATC
CCGGTGCGGCTGTGGGAAGACCTTCCGCACGCGCTCTTCGCACCGGACACACCGGAACTG
CCGGAGGGCTTTCAGCTCGGCCCTCCGATCCACGCCTCCGTCGAACCCGACCTTCGGACG
CGGAAATTCGAGGCTCTGCGGCGCTATCCATCGCAGATGTTGATGCTTCACGGACCCGAC
AAGGATCTTTTCGCTCAACTGGACGGGCATGCTCGGAAGAGCTCGGCGCAGCCCGGCTAC
GGCGAACTGACCTGGCCTGTCGTCTCTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [12-172]  3.7e-18 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [9-243]  1.1e-21 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   no description
 [6-250]  2.3e-36 SSF102588
SSF102588   LmbE-like
SignalP No significant hit
TMHMM No significant hit