close all open/close all

CDS information : Vanco_00200


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction47,597 / 48,445 / + [in whole cluster]
47,597 / 48,445 / + [in contig]
Location47597..48445 [in whole cluster]
47597..48445 [in contig]
TypeCDS
Length849 bp (282 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative SAM-dependent N-methyltransferase
Product (GenBank)vancomycin putative N-methyltransferase
Gene
Gene (GenBank)vmt
EC number2.1.1.-
Keyword
  • Leu1
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52805
NITE
Chlor_00170
PmId
[19389626] Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. (Chem Biol. , 2009)
ACC
R4T056
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative SAM-dependent N-methyltransferase [vancomycin putative N-methyltransferase]
MSEQLTRSPLRTAYADVLLASAGERGVLCGFYDEAAAEIYRDLVQDGDGGPEVRAIAARV
RPGSGPVLELAAGMGRLTFPFLELGWEMTALELAPAVITAFRDRLAAATADVRDRCTVVQ
GDMSDFALGKRFGTVVISAGSLNVLDRSRRPGLYASVRDHLEPGGKLLFGVPKPPPAKPE
PEPLERRQEFTGRSGRRYVLHARNIPAEETQEITIHPADVTADPLLVCTHRIWHIGVEQA
MEELTLAGFEVTAPSSFGSIEGSSDDMVLVEAVAREITEGAE
selected fasta
>putative SAM-dependent N-methyltransferase [vancomycin putative N-methyltransferase]
ATGAGTGAACAGTTGACGCGTAGCCCGTTGCGGACCGCGTACGCCGACGTCCTGCTGGCT
TCGGCAGGCGAGCGAGGCGTGCTGTGCGGTTTCTACGACGAGGCCGCCGCGGAAATCTAC
CGGGATCTGGTACAGGACGGGGACGGCGGCCCGGAAGTGCGGGCGATCGCCGCCCGCGTC
CGCCCGGGCTCCGGGCCCGTCTTGGAACTCGCGGCGGGTATGGGCAGGCTGACGTTCCCG
TTCCTGGAGCTCGGCTGGGAAATGACCGCGCTGGAACTGGCTCCCGCGGTGATCACCGCC
TTCCGGGACCGGCTGGCCGCAGCGACGGCGGACGTCCGTGATCGATGCACGGTCGTCCAG
GGCGACATGAGCGATTTCGCGCTGGGCAAGCGTTTCGGCACGGTGGTCATCAGCGCCGGC
TCGCTCAACGTCCTGGACAGATCCCGCAGACCCGGCCTGTACGCGTCGGTCCGGGACCAT
CTCGAGCCCGGCGGGAAACTGTTGTTCGGCGTGCCCAAGCCGCCGCCGGCCAAACCCGAG
CCCGAGCCGCTGGAGCGCCGGCAAGAGTTCACGGGCCGGAGCGGACGGCGGTACGTGCTG
CACGCGAGGAACATTCCGGCGGAGGAGACCCAGGAGATCACCATCCACCCCGCCGACGTG
ACGGCGGATCCCCTTCTCGTTTGCACGCACCGAATCTGGCATATCGGGGTGGAGCAGGCC
ATGGAGGAACTGACGCTGGCGGGCTTCGAGGTGACCGCGCCGAGTTCATTCGGGTCCATC
GAGGGAAGCAGTGACGACATGGTGCTGGTGGAGGCGGTCGCCCGCGAAATCACGGAAGGC
GCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit