close all open/close all

CDS information : Vanco_00210


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction49,730 / 48,426 / - [in whole cluster]
49,730 / 48,426 / - [in contig]
Locationcomplement(48426..49730) [in whole cluster]
complement(48426..49730) [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative aminotransferase
Product (GenBank)phenylglycine aminotransferase
Gene
Gene (GenBank)pgat
EC number2.6.1.-
Keyword
  • Hpg
  • Dpg
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52815
NITE
Chlor_00180
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
ACC
Q939Y4
NITE
Balhi_00210
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
ACC
R4SKH8
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative aminotransferase [phenylglycine aminotransferase]
MEILVFMDSNGLSTQLSMETLHGSLTDPAISSMNLLNELIDEYPVAISMAAGRPYEEFFD
VRLIHEYIDAYCEHLRGDRKLNEAAVTRTLFQYGTTKGVIADLIARNLAEDEDIDAAPES
VVVTVGAQEAMFLVLRTLRAGERDVLLAPAPTYVGLTGAALLTDTPVWPVRSGENGIDPD
DLALQLKRADEQGKRVRACYVTPNFANPTGTSMDLASRHRLLEVAEAHGILLLEDNAYGL
FGAERLPSLKSLDRSGSVVYIGSFAKTGMPGARVGYVVADQQVPGGGLLADQLSKLKGML
TVNTSPIAQAVIAGKLLLNGFSLVKANAREVDIYQRNLRLTLGELDRRLGAFPDVTWNTP
TGGFFVTVTVPFVVDDELLERAARDHGVLFTPMHHFFGGKGGFHQLRLSISLLTPELIEE
GVSRLAALITPRLP
selected fasta
>putative aminotransferase [phenylglycine aminotransferase]
ATGGAAATCCTAGTATTTATGGATTCGAACGGTTTGTCCACTCAGTTGAGCATGGAAACA
CTGCATGGATCACTCACCGATCCGGCCATCTCGTCGATGAACCTGCTCAACGAGCTGATC
GACGAATATCCTGTCGCCATTTCCATGGCGGCGGGCCGCCCGTACGAAGAGTTCTTCGAC
GTGCGGCTCATTCACGAATACATCGACGCTTATTGTGAACACCTCCGCGGTGACCGGAAA
CTGAACGAAGCGGCGGTCACCCGCACGCTCTTCCAATACGGGACCACCAAGGGCGTCATC
GCCGATCTCATCGCCCGCAATCTCGCCGAGGACGAGGACATCGACGCCGCCCCCGAATCC
GTGGTCGTCACCGTGGGCGCCCAGGAGGCGATGTTCCTGGTCCTCCGCACGCTGCGGGCG
GGCGAGCGGGACGTGCTGCTCGCCCCCGCCCCCACCTACGTCGGCCTGACCGGGGCGGCG
CTGCTCACCGACACCCCGGTCTGGCCGGTCCGGTCAGGTGAGAACGGCATCGACCCCGAC
GACCTCGCGCTCCAGCTGAAGCGCGCCGACGAACAGGGAAAACGGGTCCGGGCCTGCTAT
GTGACGCCGAACTTCGCCAACCCGACCGGCACGAGCATGGACCTGGCTTCCCGCCACCGT
CTCCTCGAAGTCGCCGAAGCGCACGGGATCCTGCTCCTGGAGGACAACGCGTACGGGCTC
TTCGGCGCCGAGCGGCTTCCCTCGCTGAAATCCCTCGACCGGTCGGGAAGCGTGGTCTAC
ATCGGTTCCTTCGCCAAGACCGGCATGCCGGGCGCCCGGGTCGGTTACGTGGTGGCGGAT
CAGCAGGTGCCCGGGGGCGGTCTGCTCGCCGACCAGCTTTCGAAGCTCAAGGGCATGCTC
ACGGTGAACACCTCCCCCATCGCGCAGGCGGTGATCGCCGGAAAGCTCCTTCTCAACGGT
TTCAGCCTGGTCAAGGCCAACGCCCGCGAGGTCGACATCTACCAGCGCAATCTCCGGCTC
ACCTTGGGCGAACTCGACCGCAGGCTCGGCGCGTTCCCCGACGTCACCTGGAACACGCCG
ACCGGTGGCTTCTTCGTCACCGTCACCGTGCCCTTCGTCGTCGACGACGAATTGCTGGAA
CGCGCCGCCCGCGATCACGGCGTGCTGTTCACGCCGATGCATCATTTCTTCGGTGGCAAG
GGTGGATTCCACCAGCTCCGGCTCTCGATCAGCCTGCTCACGCCGGAACTGATCGAAGAA
GGCGTCTCGCGGCTCGCGGCGCTCATCACTCCGCGCCTTCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [83-425]  1.4e-30 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [84-306]  7.1e-43 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [307-428]  2.2e-05 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-429]  1.5e-73 SSF53383
SSF53383   PLP-dependent transferases
SignalP No significant hit
TMHMM No significant hit