close all open/close all

CDS information : Vanco_00220


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction50,074 / 50,904 / + [in whole cluster]
50,074 / 50,904 / + [in contig]
Location50074..50904 [in whole cluster]
50074..50904 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)vancomycin putative hydrolase
Gene
Gene (GenBank)vhp
EC number
Keyword
  • Bht
  • unusual type
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q939Y3
NITE
Balhi_00220
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[19998400] The thioesterase Bhp is involved in the formation of beta-hydroxytyrosine during balhimycin biosynthesis in Amycolatopsis balhimycina. (Chembiochem. , 2010)
ACC
R4SMZ4
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative thioesterase [vancomycin putative hydrolase]
MLMTTENGIRLSYHDQGSGPAVLLLTGTGAPSSVWDLHQVPALRAAGFRVITMDNRGIPP
SDDGAGGFTIEDLVADVAALIDYLDASPCHVIGTSMGSYIAQELALAHPELLESVVLMAA
CGRSSLVQRVLAESEAELIGRGTELPPGYLAAVRAMHNLGPATLADDDLAGDWLDLFEAS
GNWGPGVRAQLLLSALPDRREAYRAIKVPCHVISFEHDLVAPPAAGRELATVIPGATHHT
IPGGGHFGYLENPEAVNHELLGFLRSGSGARLGETA
selected fasta
>putative thioesterase [vancomycin putative hydrolase]
ATGCTGATGACAACCGAGAACGGGATCCGGTTGTCTTACCACGACCAAGGCTCCGGTCCG
GCTGTCCTGTTGCTGACCGGGACCGGGGCGCCGAGTTCCGTATGGGATCTGCATCAGGTG
CCCGCGCTCCGTGCCGCCGGATTCCGGGTGATCACCATGGACAACCGGGGGATCCCGCCG
AGCGACGACGGTGCCGGCGGGTTCACCATCGAAGACCTCGTCGCGGACGTGGCCGCCCTG
ATCGACTACCTCGACGCGTCGCCGTGTCACGTGATCGGCACGTCGATGGGCTCGTACATC
GCGCAGGAACTGGCGCTCGCGCATCCGGAGCTGCTGGAGTCCGTGGTGCTGATGGCGGCG
TGCGGCCGGAGCAGCCTCGTCCAGCGGGTGCTCGCCGAGAGCGAGGCCGAGCTGATCGGG
CGGGGGACCGAACTGCCGCCGGGGTATCTCGCCGCCGTGCGCGCCATGCACAACCTGGGG
CCCGCCACCCTCGCCGACGACGATCTCGCCGGCGACTGGCTCGACCTGTTCGAGGCGTCG
GGGAACTGGGGGCCCGGGGTCCGCGCGCAGTTGTTGCTGAGCGCGCTGCCCGACCGCCGC
GAGGCCTATCGCGCGATCAAGGTGCCCTGCCACGTCATTTCCTTCGAACACGACCTCGTG
GCGCCGCCGGCCGCGGGACGGGAGCTGGCCACCGTGATCCCTGGCGCCACACACCACACG
ATCCCGGGTGGTGGGCATTTCGGCTATCTGGAGAACCCGGAGGCGGTGAACCACGAGTTG
CTCGGGTTCCTGCGTTCCGGGTCCGGCGCACGCCTGGGGGAGACCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [47-62]  1.10000029896148e-06 PR00111 [91-104]  1.10000029896148e-06 PR00111 [105-118]  1.10000029896148e-06 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [47-62]  3.79999862644791e-07 PR00412 [208-224]  3.79999862644791e-07 PR00412 [241-263]  3.79999862644791e-07 PR00412
PR00412   EPOXHYDRLASE
SignalP No significant hit
TMHMM No significant hit