close all open/close all

CDS information : Vanco_00230


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction50,901 / 52,664 / + [in whole cluster]
50,901 / 52,664 / + [in contig]
Location50901..52664 [in whole cluster]
50901..52664 [in contig]
TypeCDS
Length1,764 bp (587 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative L-tyrosine--PCP ligase/peptidyl carrier protein
putative L-tyrosyl-PCP synthetase/peptidyl carrier protein
Product (GenBank)non-ribosomal peptide synthetase D
Gene
Gene (GenBank)vpsD
EC number
Keyword
  • Bht
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q939Y2
NITE
Balhi_00230
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[20519494] Structural characterization of OxyD, a cytochrome P450 involved in beta-hydroxytyrosine formation in vancomycin biosynthesis. (J Biol Chem. , 2010)
ACC
R4SV98
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionPKS/NRPS Module

B1 tyrosine
A43..435
PCP516..583

close this sectionSequence

selected fasta
>putative L-tyrosine--PCP ligase/peptidyl carrier protein [non-ribosomal peptide synthetase D]
MTETTMSPDLAVPAAGTTPALFEATAASVPDRPAVAMGTTTLTYAELNAEANRLARRLVA
HGVGPERLVALAMPRSIEFVVAMLAVHKAGGAYVPVDPDYPEERRRHMLDDASAHCLLCL
PGQDVSGAGDIMSVVREPGASEPNLDDQDRLGPLLPDHPAYVIYTSGSTGRPKGVVVTHR
GIPNLAADYVRRQRLGPDDRLLAFASPSFDAAVAEFWPMWAAGGCLVLAPAPDLVPGEPL
ARLVREQAISHVTLPPSALAPLEDAGGLPPGVTLLVAGEACPAPVAKRWASDRVMINAYG
PTETTVAVTASDPLTGDGTPPIGKPITGVRAYVLDDRLRPVPDEDEGELYAVGPGLARGY
LRRPGATAVRFLPDPFGEPGGRMYRTGDRVRRRPDGQLVFVGRVDDQLKVRGHRIEPGEV
ETALLAAGGVAQAVVTEHENRLVAYVVGTAGERVSAEELLPPLRKRLPSYLVPDVVVSLP
SLPVSPNGKVDRTALPTPEEEHAGRSASGRAPLTPTEIILAELFAEVLGVGSVGVEDSFF
EIGGHSLLATRLVSRIRERLKTRLRVQAFFDAPTVAQLAKVLDGALT
selected fasta
>putative L-tyrosine--PCP ligase/peptidyl carrier protein [non-ribosomal peptide synthetase D]
ATGACCGAGACGACCATGTCACCCGATCTCGCCGTACCCGCGGCGGGCACGACACCCGCG
CTGTTCGAGGCGACCGCCGCCTCGGTGCCGGACAGGCCCGCCGTCGCGATGGGCACCACC
ACCCTGACCTACGCCGAGCTGAACGCGGAAGCCAACCGGCTCGCGCGGCGGCTCGTGGCG
CACGGGGTCGGCCCGGAACGGCTGGTCGCGCTGGCCATGCCGCGGTCGATCGAGTTCGTC
GTCGCGATGCTGGCCGTGCACAAGGCGGGCGGCGCGTACGTGCCCGTCGATCCGGACTAT
CCCGAGGAACGACGGCGGCACATGCTGGACGACGCGTCCGCGCACTGTCTGCTGTGCCTG
CCTGGACAGGACGTCTCGGGTGCCGGGGACATCATGAGCGTGGTGCGGGAGCCGGGCGCG
TCCGAGCCGAACCTGGACGATCAGGACCGGCTCGGCCCCTTGCTCCCCGATCACCCCGCC
TACGTCATCTACACCTCGGGCTCGACCGGACGGCCGAAGGGCGTGGTGGTCACCCATCGC
GGCATCCCGAACCTGGCCGCGGACTACGTGCGCCGCCAGCGACTGGGGCCGGACGACCGG
TTGCTGGCCTTCGCGTCGCCCAGTTTCGACGCCGCCGTCGCCGAGTTCTGGCCGATGTGG
GCGGCCGGTGGCTGCCTGGTGCTCGCGCCCGCGCCGGATCTCGTCCCCGGCGAACCGCTC
GCCCGGCTGGTCCGGGAGCAGGCCATCTCCCACGTCACGTTGCCGCCGTCCGCCTTGGCG
CCGCTGGAGGACGCCGGCGGCCTGCCGCCGGGGGTGACGCTCCTGGTGGCGGGCGAGGCG
TGCCCGGCGCCGGTCGCGAAACGCTGGGCGAGCGACCGCGTCATGATCAACGCCTACGGC
CCCACCGAGACCACGGTCGCGGTGACCGCGAGCGACCCGCTGACCGGCGACGGCACCCCG
CCGATCGGGAAGCCGATCACCGGCGTCCGCGCGTACGTCCTCGACGACCGGCTGCGGCCC
GTCCCGGACGAGGACGAGGGCGAGCTTTACGCCGTGGGTCCCGGCCTCGCCCGGGGCTAC
CTCCGCCGGCCGGGCGCGACCGCGGTGCGGTTCCTGCCGGATCCCTTCGGTGAACCGGGC
GGCCGCATGTACCGCACCGGCGACAGGGTGCGGAGGCGGCCGGACGGCCAGCTCGTCTTC
GTCGGCCGCGTCGACGACCAGCTGAAGGTCCGTGGCCACCGGATCGAACCGGGGGAGGTC
GAGACGGCGCTGCTCGCGGCCGGCGGGGTGGCGCAGGCCGTCGTGACCGAGCACGAGAAC
CGGCTCGTCGCCTACGTGGTCGGTACCGCGGGCGAACGGGTTTCGGCCGAAGAACTGTTG
CCACCGCTGCGAAAGCGGTTGCCCTCGTATCTCGTCCCCGACGTGGTCGTCAGCCTGCCG
AGCCTGCCGGTCTCGCCGAACGGCAAGGTCGACCGGACCGCCCTGCCCACTCCCGAAGAG
GAGCACGCCGGGCGGTCGGCCTCGGGCCGGGCGCCGCTCACCCCCACGGAGATCATCCTG
GCCGAGTTGTTCGCCGAAGTGCTCGGCGTCGGCAGCGTCGGCGTCGAGGACAGCTTCTTC
GAGATCGGCGGCCACTCGCTGCTCGCGACCCGGCTGGTGAGCCGGATCCGCGAACGCCTG
AAGACCCGGCTGAGAGTGCAGGCCTTCTTCGACGCGCCGACCGTGGCACAGCTCGCCAAG
GTGCTCGACGGCGCACTCACCTGA
[1] A43..435
[1] tyrosine210..307
[1] PCP516..583
[1] A127..1305
[1] tyrosine628..921
[1] PCP1546..1749

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [43-435]  1.69999999999998e-113 PF00501
PF00501   AMP-binding
IPR006162 Phosphopantetheine attachment site (PTM)
 [541-556]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [520-580]  1.9e-13 PF00550
PF00550   PP-binding
 [509-584]  5.69999708783953e-21 SSF47336
SSF47336   ACP_like
 [506-584]  1.1e-27 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [516-583]  PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [43-435]  1.39999999999997e-128 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020459 AMP-binding (Domain)
 [157-168]  7.49999605851445e-05 PR00154 [169-177]  7.49999605851445e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [162-173]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit