close all open/close all

CDS information : Vanco_00240


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction52,679 / 53,869 / + [in whole cluster]
52,679 / 53,869 / + [in contig]
Location52679..53869 [in whole cluster]
52679..53869 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative cytochrome P450
Product (GenBank)P450 monooxygenase D
Gene
Gene (GenBank)oxyD
EC number
Keyword
  • Bht
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q939Y1
NITE
Balhi_00240
PmId
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
[20519494] Structural characterization of OxyD, a cytochrome P450 involved in beta-hydroxytyrosine formation in vancomycin biosynthesis. (J Biol Chem. , 2010)
ACC
R4SZ88
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 monooxygenase D]
MQTTTAVDLGNPDLYTTLDRHTRWREFATEDAMVWSEPGSSPTGFWSVFSHRACAAVLGP
SAPFTSEYGMMIGFDREHPDTSGGQMMVVSEQDQHRRLRKLVGPLLSRAAARKLAERVRT
EVRGVLDKVLDGEVCDVAAAIGPRIPAAVVCEILGVPAEDEDMLIDLTNHAFGGEDELFD
GMTPRQAHTEILVYFDELIAARRERPGDDLVSTLLTDDELTIDDVVLNCDNVLIGGNETT
RHAITGAVHAFATVPGLLARVRDGDEDVDTVVDEVLRWTSPAMHVLRVTTGEVTINGRDL
APGTPVVAWLPAANRDPAVFDDPDTFRPGRKPNRHIAFGHGMHHCLGSALARIELAVVVR
ELAERVSRVELAKEPAWLRAIVVQGYRELPVRFTGR
selected fasta
>putative cytochrome P450 [P450 monooxygenase D]
ATGCAGACGACCACAGCCGTCGACCTCGGCAACCCGGATCTGTACACGACCTTGGATCGC
CACACCCGCTGGCGTGAGTTCGCGACGGAAGACGCGATGGTGTGGAGCGAGCCGGGCAGT
TCGCCCACCGGCTTCTGGTCCGTCTTCTCGCACCGGGCGTGCGCGGCGGTCCTCGGGCCG
TCCGCGCCGTTCACCTCCGAGTACGGGATGATGATCGGCTTCGACCGTGAGCATCCTGAC
ACCTCGGGTGGCCAGATGATGGTGGTCTCCGAACAGGATCAGCACCGCAGACTGCGCAAG
CTGGTCGGCCCACTGCTTTCGCGGGCGGCCGCGCGGAAACTCGCGGAGCGGGTGCGGACC
GAGGTGCGCGGTGTGCTCGACAAGGTGCTCGACGGCGAGGTGTGCGACGTCGCCGCGGCG
ATCGGCCCGCGTATCCCCGCCGCGGTCGTCTGCGAGATCCTCGGTGTGCCGGCCGAGGAC
GAGGACATGCTCATCGACCTGACCAACCACGCGTTCGGCGGCGAGGACGAACTGTTCGAC
GGGATGACGCCGAGGCAGGCGCATACCGAGATCCTCGTCTACTTCGACGAACTGATCGCC
GCCCGCCGCGAGCGTCCCGGCGACGACCTCGTCAGCACGCTGCTGACCGACGACGAGCTC
ACGATCGACGACGTGGTGCTCAACTGCGACAACGTGCTGATCGGCGGCAACGAGACCACC
CGGCACGCGATCACCGGCGCGGTGCACGCCTTCGCCACCGTGCCGGGCCTGCTCGCGCGG
GTGCGGGACGGCGACGAAGACGTCGACACCGTGGTGGACGAGGTGCTGCGCTGGACCTCG
CCCGCGATGCACGTGCTGCGGGTGACGACCGGCGAGGTCACGATCAACGGACGGGACCTC
GCGCCCGGGACGCCGGTGGTCGCGTGGTTGCCCGCCGCGAACCGGGATCCCGCCGTGTTC
GACGATCCGGACACGTTCCGCCCCGGGCGGAAACCCAATCGGCACATCGCTTTCGGGCAC
GGGATGCACCACTGTCTCGGCTCCGCGCTCGCCCGCATCGAACTGGCGGTCGTGGTGCGG
GAACTGGCCGAACGGGTGTCGCGAGTGGAACTGGCCAAGGAACCGGCCTGGTTGCGCGCG
ATCGTCGTGCAGGGTTACCGGGAACTCCCGGTGCGGTTCACCGGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [209-359]  2.5e-20 PF00067
PF00067   p450
 [235-252]  6.59999852526375e-05 PR00385 [270-281]  6.59999852526375e-05 PR00385 [336-345]  6.59999852526375e-05 PR00385 [345-356]  6.59999852526375e-05 PR00385
PR00385   P450
 [9-396]  1.09999184471405e-85 SSF48264
SSF48264   Cytochrome_P450
 [18-396]  8.19999999999987e-96 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [90-101]  1.99999636034521e-44 PR00359 [136-152]  1.99999636034521e-44 PR00359 [153-168]  1.99999636034521e-44 PR00359 [193-215]  1.99999636034521e-44 PR00359 [270-281]  1.99999636034521e-44 PR00359 [287-314]  1.99999636034521e-44 PR00359 [315-330]  1.99999636034521e-44 PR00359 [336-345]  1.99999636034521e-44 PR00359 [345-356]  1.99999636034521e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [338-347]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit