close all open/close all

CDS information : Vanco_00250


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction53,998 / 55,038 / + [in whole cluster]
53,998 / 55,038 / + [in contig]
Location53998..55038 [in whole cluster]
53998..55038 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)4-hydroxyphenylpyruvate dioxygenase
Gene
Gene (GenBank)hmaS
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)
ACC
R4T059
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [4-hydroxyphenylpyruvate dioxygenase]
MQNFEIDQVEMYVADLEAAASGWMDKYGFSVASTDRSADHRSVTLRQGPIALVLTEPTSD
RHPAATYLQTHGDGVADIALRTSDVAAAFEAAVRAGAQPILEPGERAEGVITATVGGFGD
VVHTLIQRDTVESPEAFRGRGGIDLLAIDHFAVCLNAGDLGPTVDYYERALGFKQIFEEH
IVVGAQAMNSTVVQSASGEVTLTLIEPDKTADPGQIDDFIKEHHGAGVQHIAFTSADAVR
AVKELSARGVEFLKTPDTYYDLLGERIQLETHSLDDLRETKLLADEDHGGQLFQIFTAST
HPRKTIFFEIIERQGAGTFGSSNIKALYEAVELERTGQSKLGPARR
selected fasta
>putative 4-hydroxymandelate synthase [4-hydroxyphenylpyruvate dioxygenase]
ATGCAGAATTTCGAGATCGACCAGGTGGAAATGTATGTGGCCGACCTCGAGGCGGCCGCG
TCCGGCTGGATGGACAAGTACGGGTTTTCCGTCGCCTCCACCGACCGGTCGGCCGACCAC
CGGAGCGTGACGCTGCGGCAGGGGCCGATCGCGCTGGTCCTCACCGAGCCGACGTCGGAC
CGGCACCCGGCGGCCACCTATCTGCAGACCCACGGTGACGGGGTGGCCGACATCGCGCTG
CGGACTTCGGACGTGGCCGCCGCTTTCGAGGCCGCGGTGCGGGCCGGGGCACAGCCGATC
CTGGAGCCGGGTGAGCGCGCGGAGGGGGTCATCACGGCCACCGTCGGCGGTTTCGGCGAT
GTCGTGCACACCCTGATCCAGCGTGACACCGTCGAATCGCCGGAAGCCTTCCGCGGCAGG
GGCGGTATCGACCTGCTCGCGATCGATCACTTCGCGGTCTGCCTGAACGCGGGGGATCTC
GGCCCCACGGTGGATTACTACGAGCGCGCCCTCGGGTTCAAGCAGATCTTCGAGGAGCAC
ATCGTCGTCGGTGCGCAGGCGATGAACTCCACCGTCGTGCAGAGCGCGTCGGGGGAGGTC
ACCCTCACCCTGATCGAGCCCGACAAGACCGCCGACCCCGGCCAGATCGACGACTTCATC
AAGGAGCACCACGGTGCGGGCGTCCAGCACATCGCCTTCACCAGTGCGGACGCGGTCCGC
GCGGTCAAGGAGCTTTCCGCGCGGGGCGTGGAATTCCTGAAGACCCCGGACACCTACTAC
GACCTGCTCGGCGAGCGGATCCAGCTGGAGACGCATTCGCTGGACGATCTGCGGGAGACG
AAGCTGCTCGCCGACGAGGACCACGGCGGCCAGCTGTTCCAGATCTTCACCGCGTCCACG
CATCCGCGTAAGACCATCTTCTTCGAGATCATCGAGAGGCAGGGCGCCGGCACCTTCGGC
AGCTCCAACATCAAGGCCCTGTACGAGGCCGTGGAGCTGGAGCGGACCGGGCAGAGCAAG
CTCGGCCCCGCCCGTCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [148-295]  6.3e-20 PF00903
PF00903   Glyoxalase
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [5-339]  2.30000000000004e-113 TIGR01263
TIGR01263   4HPPD
 [1-342]  PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit