close all open/close all

CDS information : Vanco_00270


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction56,142 / 57,494 / + [in whole cluster]
56,142 / 57,494 / + [in contig]
Location56142..57494 [in whole cluster]
56142..57494 [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)sodium hydrogen exchanger
Gene
Gene (GenBank)ORF100
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SMZ9
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
Q939X8
NITE
Balhi_00270
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [sodium hydrogen exchanger]
MLLSLPAPIAPIAAHSLLLFLLQAGLLLLLAVTFGRLAARFGMPAVVGELFVGVILGPSL
LAWAAPGLHGWLFPAVAEQYHLLDAVGQIGVLLLVGLTGMQMDMRMVRRRFGAAAGVGLG
GLIIPLGLGIGAGFVLPKTLIPGGTDITVFALFLGVAMCVSAIPVIAKTLIDMNLLHRNV
GQLTLAAGMIDDVFGWLMLSVVSAMAVQAASAGTVLLSLAYLVAIVAFAFTLGRPLTRGV
LRIAGKSDGPWATVGTVVALLLLASAGTHALGMEALFGAFVCGILIGTAGKVDPAKLAPL
RTVILSVFAPLFFATAGLRMDLTALVRPEVLLTGLAVLLLAIIGKFVGVFAGARFSGLNK
WEGLALGAGLNARGVIGIMVATVGLRLGILGVEIYTIVILVAIVTPLMAPPILRFAMKRL
EQTAEEQVRETEQRAWSTQTTVSEQEQPLH
selected fasta
>putative transporter [sodium hydrogen exchanger]
GTGCTTCTCTCGCTTCCCGCGCCGATCGCGCCGATCGCCGCGCACAGTCTCCTGCTTTTC
CTGCTCCAGGCGGGTTTGCTGCTCCTGCTCGCGGTCACCTTCGGGCGGCTGGCCGCCCGG
TTCGGGATGCCCGCCGTCGTCGGCGAACTGTTCGTCGGGGTGATCCTCGGCCCGTCATTG
CTGGCCTGGGCAGCGCCGGGGCTGCACGGCTGGCTGTTCCCGGCCGTCGCGGAGCAGTAC
CACCTTCTCGACGCCGTCGGCCAGATCGGGGTCCTGCTGCTGGTCGGTCTCACCGGGATG
CAGATGGACATGCGCATGGTCCGGCGGCGGTTCGGTGCCGCCGCCGGGGTCGGCCTCGGT
GGCCTGATCATCCCGCTGGGGCTGGGGATCGGCGCGGGTTTCGTCTTGCCGAAGACGTTG
ATCCCCGGAGGCACGGACATCACCGTCTTCGCGTTGTTCCTCGGCGTGGCGATGTGCGTC
AGCGCCATCCCGGTCATCGCGAAGACGCTCATCGACATGAATCTGCTGCACCGCAACGTC
GGACAGCTCACGCTCGCGGCGGGCATGATCGACGACGTCTTCGGCTGGCTGATGCTGTCC
GTCGTCAGCGCGATGGCGGTCCAGGCGGCGAGCGCCGGAACGGTGCTGCTCTCCCTCGCG
TACCTGGTCGCCATCGTCGCCTTCGCCTTCACTCTCGGCAGACCGTTGACGCGAGGCGTG
CTGCGTATCGCCGGCAAGTCCGACGGTCCGTGGGCCACGGTCGGCACCGTCGTCGCCCTG
CTGCTCCTCGCCTCGGCCGGCACGCACGCCCTCGGGATGGAGGCCCTCTTCGGTGCCTTC
GTCTGCGGCATCCTGATCGGCACGGCGGGCAAGGTCGACCCGGCCAAGCTCGCCCCGCTG
CGCACCGTGATCCTGTCGGTGTTCGCGCCGCTCTTCTTCGCCACGGCCGGTTTGCGGATG
GACCTCACCGCGCTGGTCCGGCCGGAGGTCCTGCTCACCGGGCTGGCGGTGCTGCTGCTG
GCCATCATCGGCAAGTTCGTCGGAGTGTTCGCCGGTGCGCGGTTCAGCGGCCTGAACAAA
TGGGAAGGACTGGCGCTCGGCGCCGGGCTGAACGCGCGCGGGGTCATCGGGATCATGGTG
GCCACGGTCGGCCTGCGGCTGGGCATCCTCGGCGTGGAGATCTACACGATCGTCATCCTC
GTCGCGATCGTCACCCCGCTGATGGCGCCGCCGATCCTGCGGTTCGCGATGAAGAGACTC
GAGCAGACCGCCGAAGAACAGGTGCGCGAAACCGAACAGCGGGCCTGGAGCACGCAAACG
ACGGTGAGTGAACAGGAACAGCCGCTCCATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [26-417]  7e-53 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [10-32]  Transmembrane (o-i) [45-67]  Transmembrane (i-o) [82-99]  Transmembrane (o-i) [112-134]  Transmembrane (i-o) [149-171]  Transmembrane (o-i) [183-205]  Transmembrane (i-o) [209-231]  Transmembrane (o-i) [251-273]  Transmembrane (i-o) [297-319]  Transmembrane (o-i) [331-353]  Transmembrane (i-o) [363-385]  Transmembrane (o-i) [387-409]  Transmembrane (i-o)
Transmembrane 12