close all open/close all

CDS information : Vanco_00280


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction57,923 / 59,338 / + [in whole cluster]
57,923 / 59,338 / + [in contig]
Location57923..59338 [in whole cluster]
57923..59338 [in contig]
TypeCDS
Length1,416 bp (471 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)putative NDP-hexose 2,3-dehydratase
Gene
Gene (GenBank)vcaA
EC number
Keyword
  • L-vancosamine
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SVA6
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
O52793
NITE
Chlor_00240
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)
[23473392] Structure of EvaA: a paradigm for sugar 2,3-dehydratases. (Biochemistry. , 2013)

close this sectionSequence

selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative NDP-hexose 2,3-dehydratase]
MMLSWLEPPGTVRPRDDRDHEERIALSAANTAGVQMRTEDVRAWIAERREANVFHVQHIP
FAELDQWRFEGGTGNLVHASGRFFTIEGLHVVEHDGPHGDGPYREWRQPVIKQPEVGILG
ILAKEFDGVLHFLMQAKMEPGNPNLVQLSPTVQATRSNYTKAHGGSNVKLIEYFAPPDPD
RIIVDVLQAEQGSWFYRKSNRNMIVETVDDVPLWDDFCWLTLGQIAELMHEDETINMNAR
SVLSCLPYRDTAPGAVLSDIQLLSWFTNERSRHDVRVSRIPLKDVHGWKQGAEAIEHEDG
RYFKVLAVAVKGSNREKVSWTQPLLESVGLGVAAFLVRDFGGVPHVLVHARVDGGFVDTV
ELAPTVQCTPENYAHLPPESQPPFLDTVLDAPPSRILYEAIHSEEGGRFLNVRARYLAVE
ADDTVEAPPGYAWVTPAQLTALTRHGHYVNVEARTLLACLHAAAAQPRIGA
selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative NDP-hexose 2,3-dehydratase]
GTGATGCTGTCTTGGCTGGAGCCTCCCGGCACGGTGCGTCCCCGCGACGATCGCGACCAC
GAGGAGCGCATCGCCTTGTCGGCCGCGAACACCGCCGGTGTGCAGATGCGGACCGAGGAC
GTCCGCGCCTGGATCGCGGAACGCCGTGAGGCCAACGTCTTCCACGTCCAGCACATCCCG
TTCGCGGAGCTGGACCAGTGGCGTTTCGAAGGCGGGACAGGCAATCTCGTGCACGCCAGC
GGACGGTTCTTCACCATCGAGGGCCTGCACGTCGTCGAACACGACGGCCCGCACGGTGAC
GGCCCTTACCGCGAATGGCGGCAGCCGGTCATCAAACAGCCCGAGGTGGGGATCCTCGGC
ATCCTCGCCAAGGAGTTCGACGGTGTCCTGCATTTCCTGATGCAGGCCAAGATGGAGCCG
GGAAACCCCAATCTGGTACAGCTTTCGCCGACCGTGCAGGCCACCCGCAGCAACTACACC
AAGGCGCACGGCGGCTCGAACGTCAAGCTGATCGAGTACTTCGCCCCGCCCGACCCCGAC
CGGATCATCGTCGACGTCCTCCAGGCGGAGCAGGGCTCGTGGTTCTACCGCAAGTCCAAT
CGCAACATGATCGTCGAGACCGTCGACGACGTGCCGCTGTGGGACGACTTCTGCTGGCTC
ACCCTCGGCCAGATCGCGGAACTGATGCACGAGGACGAGACGATCAACATGAACGCGCGG
AGCGTGTTGTCGTGTCTTCCCTACCGTGACACGGCTCCCGGCGCGGTGCTCTCCGACATC
CAGCTGCTGTCGTGGTTCACCAACGAGCGTTCGCGGCACGACGTGCGCGTCAGCCGCATT
CCGCTCAAGGACGTCCACGGCTGGAAGCAGGGCGCCGAAGCTATCGAGCACGAGGACGGC
CGCTACTTCAAGGTCCTCGCGGTGGCCGTGAAAGGCAGTAACCGCGAGAAGGTCAGCTGG
ACCCAGCCGCTGCTCGAATCGGTCGGGCTGGGTGTCGCCGCTTTCCTCGTACGCGACTTC
GGCGGCGTACCGCACGTTCTCGTGCACGCCCGGGTCGACGGCGGTTTCGTGGACACGGTC
GAGCTGGCGCCGACAGTCCAGTGCACGCCCGAAAATTACGCGCACCTGCCACCGGAAAGC
CAACCGCCCTTCCTCGACACCGTCCTCGACGCTCCGCCGTCGCGGATCCTTTACGAGGCC
ATACATTCCGAAGAGGGCGGCCGCTTCCTCAACGTCAGGGCCCGCTATCTCGCGGTCGAG
GCGGACGACACGGTCGAAGCACCGCCCGGCTACGCCTGGGTCACCCCGGCCCAGCTCACC
GCGCTCACCCGGCACGGGCATTACGTCAACGTCGAGGCGCGCACGCTGCTCGCCTGCCTC
CACGCCGCGGCGGCACAGCCCCGGATCGGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [37-246]  1e-82 PF03559 [259-460]  2.1e-83 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit