close all open/close all

CDS information : Vanco_00290


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction59,340 / 60,317 / + [in whole cluster]
59,340 / 60,317 / + [in contig]
Location59340..60317 [in whole cluster]
59340..60317 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-hexose C-4 ketoreductase
Product (GenBank)NAD-dependent epimerase dehydratase
Gene
Gene (GenBank)vcaE
EC number
Keyword
  • L-vancosamine
  • axial-OH
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SZ93
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
O52794
NITE
Chlor_00250
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative dTDP-hexose C-4 ketoreductase [NAD-dependent epimerase dehydratase]
MKTITVLGASGFVGSAVTRALVRQPIRLRAVARRYFTPPAGRAETTVVAADLTDRAALAE
AVAGSDAVVYLLLADGGWRAAETTDAARVNVGVMRDLVEVIGSGGGTPPLVVYSGTSMQV
GVPPREPLDGSEPDLPVTPYAMQKLAAEEILKKATANGRVRGISLRLPTVFGENTVEGGK
HDSGVVSAMARRALEGQALPIWGDGTVRRDLVHVDDVAAAFTAALAAPDSLVGAHWLLGA
GRGDRLGEVFRLVAREMAEHTGRHPVEVIRAEPPAHAPVTDSLNLVVDSTPFRKITGWRP
EISLSDGVRRTVAALTSSVEGKVRT
selected fasta
>putative dTDP-hexose C-4 ketoreductase [NAD-dependent epimerase dehydratase]
ATGAAGACGATCACCGTCCTCGGCGCGTCGGGCTTCGTCGGCTCGGCCGTCACGCGCGCG
CTCGTGCGGCAGCCGATCCGGCTGCGCGCGGTGGCGCGCAGGTACTTCACGCCGCCGGCG
GGCCGGGCCGAGACCACCGTCGTCGCCGCCGATCTCACCGACCGCGCGGCGCTCGCCGAA
GCGGTCGCGGGATCGGACGCGGTCGTGTACCTGCTCCTCGCCGACGGCGGCTGGCGGGCG
GCCGAAACCACGGATGCCGCCCGCGTGAACGTCGGCGTGATGCGGGATCTCGTCGAGGTC
ATCGGAAGCGGCGGCGGAACGCCCCCGCTGGTGGTGTACAGCGGCACCAGCATGCAGGTC
GGCGTGCCCCCTCGGGAGCCGCTCGACGGCAGCGAGCCCGACCTCCCGGTGACTCCCTAC
GCCATGCAGAAGCTGGCGGCGGAAGAGATCCTCAAGAAGGCCACGGCGAACGGCCGGGTG
CGCGGTATCAGCCTGCGGCTGCCGACCGTTTTCGGGGAGAACACGGTGGAAGGCGGGAAG
CACGACAGCGGTGTCGTGTCCGCCATGGCGCGCCGCGCGCTCGAAGGCCAGGCGCTCCCC
ATCTGGGGCGACGGGACGGTGCGGCGCGACCTGGTCCACGTCGACGACGTCGCGGCCGCG
TTCACGGCCGCGCTGGCCGCACCGGATTCGCTGGTGGGCGCCCACTGGCTGCTCGGCGCC
GGACGGGGCGATCGGCTGGGGGAGGTCTTCCGGCTGGTGGCGAGGGAAATGGCCGAGCAC
ACCGGACGGCATCCGGTCGAGGTGATCCGCGCGGAACCACCGGCACACGCGCCCGTGACG
GATTCCCTGAACCTCGTCGTCGATTCCACGCCGTTCCGGAAGATCACCGGCTGGCGCCCG
GAGATCTCGCTGTCCGACGGAGTACGCCGCACCGTCGCCGCTTTGACGTCATCAGTTGAG
GGAAAGGTTCGCACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-239]  3.40000000000004e-47 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-192]  4.80000000000001e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit