close all open/close all

CDS information : Vanco_00340


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction63,934 / 65,238 / + [in whole cluster]
63,934 / 65,238 / + [in contig]
Location63934..65238 [in whole cluster]
63934..65238 [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase
Product (GenBank)hydroxyacyl-dehydrogenase
Gene
Gene (GenBank)dpgC
EC number
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52812
NITE
Chlor_00300
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[15380180] DpgC is a metal- and cofactor-free 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase in the vancomycin biosynthetic pathway. (Chem Biol. , 2004)
ACC
R4SZ98
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [hydroxyacyl-dehydrogenase]
MTTDSPTLSLSPGLDHRALAKAAQRVDELLDGLPSPSARTPAQREAASSALDEIRAARTE
YVEAHAEEIYDRLTDGRTRYLRLDELVRAAASAYPGLVPTEAQMAAERSRRQAEKEGREI
DQGIFLRGILSAPKAGPHLLDAMLRPTARALELLPEFVETGVVRMEAASLERRDGVAYLT
LCRDDCLNAEDAQQVDDMETAVDLALLDPAVRVGMLRGGVMSHPRYAGRRVFCAGINLKK
LSSGDIPLVDFLLRRELGYIHKIVRGVATDGSWRARVIDKPWLAAVDSFAIGGGAQLLLV
FDHVVAASDAYFSLPAATEGIIPGAANYRLSRFTGPRLARQVILGGRRITADEPDARLLV
DQVVPPEEMDAAIESALAALDGDAVRANRRMVNLAEEPPDGFRRYMAEFALQQALRIYGA
DVIGKVGGFAAGSR
selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [hydroxyacyl-dehydrogenase]
GTGACCACGGATTCCCCGACGCTGTCGCTTTCGCCGGGGCTCGACCATCGAGCCCTGGCG
AAGGCGGCACAGCGTGTCGACGAGCTGCTCGACGGGTTGCCGTCGCCCTCGGCCAGGACG
CCCGCGCAGCGTGAGGCCGCGTCCTCGGCGCTGGACGAGATCAGGGCGGCGCGGACGGAG
TACGTGGAAGCGCACGCCGAGGAGATCTACGACCGGCTCACCGACGGCCGCACCCGCTAT
CTACGCCTCGACGAACTCGTCCGGGCCGCCGCGTCGGCCTATCCCGGCCTGGTGCCCACG
GAGGCGCAGATGGCGGCCGAGCGGTCCCGACGGCAGGCGGAGAAGGAAGGCCGTGAGATC
GATCAGGGCATTTTCCTGCGCGGGATCCTGAGCGCGCCGAAAGCCGGGCCGCATCTGCTC
GACGCCATGCTCAGGCCCACCGCCAGGGCGCTGGAGCTGCTGCCGGAGTTCGTCGAGACC
GGTGTGGTGCGGATGGAGGCCGCCTCCCTGGAGCGCCGTGACGGCGTCGCGTACCTGACC
CTGTGCCGGGACGACTGCCTGAACGCCGAGGACGCCCAGCAGGTCGACGACATGGAGACC
GCGGTCGATCTGGCGCTGCTCGACCCGGCCGTCCGGGTGGGGATGCTGCGGGGCGGCGTG
ATGAGCCATCCCCGGTACGCGGGGCGCCGGGTGTTCTGCGCGGGGATCAACCTCAAGAAG
CTGAGTTCGGGCGACATCCCGCTCGTCGATTTCCTCCTGCGGCGGGAATTGGGCTATATC
CACAAGATCGTGCGCGGGGTGGCCACGGACGGTTCGTGGCGAGCACGGGTGATCGACAAG
CCCTGGCTGGCGGCCGTCGATTCCTTCGCCATCGGGGGCGGGGCCCAGCTCCTGCTGGTC
TTCGACCACGTGGTGGCGGCGTCCGACGCCTATTTCTCCCTGCCCGCGGCGACCGAGGGG
ATCATTCCCGGCGCCGCGAACTACCGGCTTTCGCGGTTCACCGGGCCGCGGCTCGCCCGG
CAGGTGATCCTCGGCGGCCGCCGGATCACGGCGGACGAGCCGGACGCCCGGCTGCTCGTC
GACCAGGTCGTCCCGCCGGAGGAGATGGACGCGGCGATCGAGAGCGCGCTCGCCGCCCTC
GACGGCGACGCGGTGCGCGCCAACCGGCGCATGGTGAATCTCGCCGAGGAACCGCCGGAC
GGATTCCGCCGGTACATGGCCGAGTTCGCCCTGCAACAGGCTTTGCGCATCTACGGCGCC
GACGTGATCGGCAAGGTCGGCGGCTTCGCGGCGGGGTCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [171-391]  5.00000000000001e-22 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit