close all open/close all

CDS information : Vanco_00350


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction65,235 / 66,032 / + [in whole cluster]
65,235 / 66,032 / + [in contig]
Location65235..66032 [in whole cluster]
65235..66032 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)putative enoyl-CoA hydratase
Gene
Gene (GenBank)dpgD
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52797
NITE
Chlor_00310
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
ACC
R4T068
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA hydratase]
MSETRVRYEKKDHVAYVTMDRPAVLNAMDRRMHEELAGIWDDVEADDDVRAVVLTGAGDR
AFSVGQDLKERARLNESGVAPTTFGSGGQAGHPRLTDRFTLSKPVVARVRGYALGGGFEL
VLACDIVIAAEDAVFALPEVRLGLIAGAGGVFRLPRQLPQKVAMGYLLTGRRMDAATALR
HGLVNEVVPAAELDQCVADWTDSLVRAAPLSVRAIKEAALRSVDLPLEEAFTTSYHWEER
RRRSADAIEGVRAFAEKRDPIWTGQ
selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA hydratase]
ATGAGCGAAACCCGGGTGCGGTACGAGAAGAAGGACCACGTCGCCTACGTGACGATGGAC
CGGCCCGCCGTGCTGAACGCGATGGACCGGCGGATGCACGAGGAACTCGCCGGGATCTGG
GACGACGTCGAGGCCGACGACGACGTCAGGGCGGTGGTGCTGACCGGCGCCGGGGACCGC
GCGTTCTCCGTCGGGCAGGACCTCAAGGAACGCGCCCGGCTGAACGAATCGGGCGTCGCG
CCCACGACGTTCGGCAGCGGGGGACAGGCGGGACATCCCCGGCTGACGGACCGGTTCACG
CTGTCCAAACCGGTGGTCGCCCGGGTGCGCGGGTACGCGCTGGGCGGCGGTTTCGAGCTG
GTGCTCGCCTGCGACATCGTCATCGCCGCCGAGGACGCGGTCTTCGCGCTGCCGGAGGTC
CGGCTCGGCCTGATCGCCGGGGCGGGAGGCGTGTTCCGGCTGCCCCGGCAGCTGCCGCAG
AAGGTGGCGATGGGCTATCTGCTGACGGGGCGCCGGATGGACGCGGCCACGGCGCTGCGC
CACGGGCTGGTCAACGAGGTCGTCCCGGCGGCCGAGCTGGACCAGTGCGTCGCGGACTGG
ACCGACAGCCTGGTGCGGGCCGCCCCGCTTTCGGTCCGCGCGATCAAGGAGGCCGCGTTG
CGGTCGGTGGACCTTCCGCTCGAAGAAGCGTTCACGACGTCCTATCACTGGGAAGAGCGC
CGACGCCGGAGCGCGGACGCGATCGAGGGTGTCCGTGCCTTCGCCGAAAAACGCGATCCG
ATATGGACGGGGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [8-257]  2.29999999999998e-60 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [106-126]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit