close all open/close all
Vanco_00350 Vanco_00350   last last

CDS information : Vanco_00360


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction66,328 / 67,422 / + [in whole cluster]
66,328 / 67,422 / + [in contig]
Location66328..67422 [in whole cluster]
66328..67422 [in contig]
TypeCDS
Length1,095 bp (364 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative phospho-2-dehydro-3-deoxyheptonate aldolase
putative 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
putative DAHP synthase
Product (GenBank)putative aldolase
Gene
Gene (GenBank)ald
EC number2.5.1.54
Keyword
  • Bht
  • Hpg
  • Dpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q799B0
NITE
Balhi_00360
PmId
[20570618] Increased glycopeptide production after overexpression of shikimate pathway genes being part of the balhimycin biosynthetic gene cluster. (Metab Eng. , 2010)
ACC
Q6TZ04
PmId
[14600244] (De)regulation of key enzyme steps in the shikimate pathway and phenylalanine-specific pathway of the actinomycete Amycolatopsis methanolica. (Microbiology. , 2003)
ACC
P0AB91
PmId
[1682314] Analysis of the metal requirement of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from Escherichia coli. (J Biol Chem. , 1991)
[8778789] Purification, crystallization, and preliminary crystallographic analysis of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from Escherichia coli. (Proteins. , 1996)
[12126632] Allosteric inhibition of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase alters the coordination of both substrates. (J Mol Biol. , 2002)

close this sectionSequence

selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [putative aldolase]
MMTTIAAVDLDNQRIDRMVPLVTPALLHHELPLSATAADTVREGRETVVRVLNGEDDRLI
VIAGPCSIHDPAAALEYADRLAAIGARFVDDLVIVMRVYFEKPRTVGGWKGLINDPHLDG
SGDVNHGLRIARDLLLELAEGGLPTASEWLDTTIPAYLADTVSWGAIGARTVESQNHRML
ASGLSMPVGFKNRRDGDVTVAVDAIRAAEARHVVPGVDPSGLPAILHTVGNPDCHLVLRG
GNSAPNHYPASVRAALATLQNAGLTRRVVIDASHDNSRKDHLQQPVVAEQIAQQIRTGQR
GIAGVMLESNLKAGRQDLHPDQPLTYGQSITDACIDIAATQNVLQTLATATAARRRSGKR
ADDR
selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [putative aldolase]
GTGATGACAACCATTGCCGCTGTCGATCTCGACAACCAGCGCATCGACCGGATGGTCCCC
TTGGTCACTCCCGCCCTCCTGCACCACGAACTCCCGCTCAGCGCCACCGCGGCCGACACG
GTGCGGGAAGGCCGCGAAACCGTCGTCCGCGTCCTCAACGGTGAGGACGACCGGCTGATC
GTGATCGCCGGGCCCTGTTCCATCCACGACCCCGCCGCGGCACTCGAGTACGCCGACCGA
CTCGCCGCCATCGGCGCCCGGTTCGTCGACGACCTCGTGATCGTCATGCGCGTGTACTTC
GAAAAGCCGCGGACGGTCGGCGGCTGGAAGGGGCTCATCAACGATCCCCATCTCGACGGC
AGCGGCGACGTCAACCACGGGTTGCGCATCGCCAGGGATCTCCTTCTCGAACTCGCGGAA
GGCGGCCTGCCCACGGCGAGCGAATGGCTCGACACCACCATTCCGGCCTACCTCGCCGAC
ACCGTCTCCTGGGGCGCGATCGGCGCCCGCACCGTCGAAAGCCAGAACCACCGCATGCTC
GCCAGCGGACTGTCGATGCCCGTCGGCTTCAAGAACCGCCGTGACGGCGATGTCACCGTC
GCGGTCGACGCGATCCGTGCCGCCGAGGCACGTCATGTGGTGCCCGGCGTCGACCCCAGC
GGCCTGCCCGCGATCCTGCACACCGTCGGCAACCCCGACTGTCATCTCGTGCTGCGCGGC
GGGAACAGCGCGCCCAACCACTACCCCGCCTCGGTCCGCGCGGCGCTCGCCACGCTCCAG
AACGCCGGGCTGACCCGCCGGGTCGTGATCGACGCCAGCCACGACAACAGCCGGAAGGAC
CACCTCCAGCAGCCCGTCGTCGCCGAGCAGATCGCCCAGCAGATCAGGACCGGCCAGCGC
GGGATCGCCGGTGTCATGCTGGAGTCCAACCTCAAGGCGGGCCGCCAGGACCTGCACCCC
GACCAGCCGCTCACCTACGGCCAGTCGATCACCGACGCCTGTATCGACATCGCCGCCACC
CAGAACGTGCTCCAGACCCTCGCCACGGCGACCGCCGCCCGCCGCCGCAGCGGCAAGCGG
GCGGACGACCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006218 DAHP synthetase I/KDSA (Domain)
 [50-344]  1.29999999999998e-86 PF00793
PF00793   DAHP_synth_1
IPR006219 DHAP synthase, class 1 (Family)
 [11-355]  TIGR00034
TIGR00034   AroFGH
 [2-359]  PIRSF001361
PIRSF001361   DAHP_synthase
IPR013785 Aldolase-type TIM barrel (Domain)
 [14-357]  G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit
Vanco_00350 Vanco_00350   last last