close all open/close all

CDS information : Vicen_00020


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction695 / 1,762 / + [in whole cluster]
695 / 1,762 / + [in contig]
Location695..1762 [in whole cluster]
695..1762 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)dTDP-glucose synthase
Gene
Gene (GenBank)vinA
EC number2.7.7.24
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dTDP-glucose synthase]
MKALVLSGGSGTRLRPITHTSAKQLVPVANKPILFYVLESIAEAGITDVGIVVGHTAPEV
QDAVGDGSAFGVDVTYIAQDEPLGLAHAVRISRDYLGDDDFVMFLGDNFIIDGVTGLVDR
FRDERPDAQILLTRVPDPRAFGVAVLDEQGRVIGLEEKPEHPRSDLALAGVYFFTPLIHE
AVWAVKPSWRGELEITDSIQHLIDTGADVRSHIIDGYWKDTGNVVDILEVNRIILESVET
AIDGDVDADSEIIGRVVIEKGATVKGSRIVGPALIATGTEIRDSYVGPFTSVAENCRIHD
SELEFSIMMRDSSLTGIRRIEASLIGRHVHGTAVPRVPNAHRLVLGDHSTFQISS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dTDP-glucose synthase]
GTGAAAGCGCTCGTTTTGTCTGGCGGATCCGGTACACGGCTCCGACCGATCACACACACA
TCAGCCAAACAACTGGTGCCCGTTGCGAACAAGCCCATCCTGTTCTACGTCCTGGAGTCG
ATCGCCGAAGCGGGCATCACCGACGTTGGCATCGTTGTCGGACACACCGCTCCGGAGGTC
CAGGACGCGGTCGGTGACGGCTCCGCCTTCGGGGTGGACGTCACCTACATCGCCCAGGAC
GAGCCGCTCGGCCTCGCCCACGCGGTCCGCATCTCCCGCGACTACCTCGGTGATGACGAC
TTTGTCATGTTCCTCGGTGACAACTTCATCATCGACGGCGTCACCGGACTTGTCGACCGC
TTCCGTGATGAGCGCCCCGACGCGCAGATCCTGCTGACCCGGGTCCCCGACCCCCGGGCC
TTCGGCGTCGCCGTCCTCGACGAACAGGGCCGCGTCATCGGCCTGGAGGAGAAGCCAGAA
CACCCCCGCAGCGATCTGGCGCTCGCCGGCGTCTACTTCTTCACCCCCCTCATCCACGAG
GCCGTCTGGGCCGTCAAACCCTCCTGGCGCGGCGAACTGGAGATCACTGACTCCATCCAG
CACCTCATCGACACCGGAGCCGACGTCCGCTCCCACATCATCGACGGGTACTGGAAGGAC
ACCGGGAACGTCGTCGACATCCTGGAGGTCAACCGCATCATCCTGGAGAGCGTCGAGACC
GCCATCGACGGCGACGTCGACGCGGACTCCGAGATCATCGGCCGGGTCGTCATCGAGAAG
GGCGCCACCGTCAAGGGCTCGCGGATCGTGGGCCCCGCCCTCATCGCCACCGGAACCGAG
ATCCGCGACTCCTACGTCGGACCCTTCACCTCCGTCGCCGAGAACTGTCGCATCCACGAC
AGCGAACTGGAGTTCTCCATCATGATGCGGGACTCGTCCCTCACCGGCATCCGCCGCATC
GAGGCGTCGCTCATCGGCCGCCATGTCCACGGCACCGCCGTACCCCGCGTACCCAACGCC
CACCGGCTCGTCCTCGGCGACCACAGCACCTTCCAGATCAGCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-234]  1.9e-58 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-351]  TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-22]  0.345 Signal
Bacteria, Gram-positive   
TMHMM No significant hit