close all open/close all

CDS information : Vicen_00030


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction1,759 / 2,730 / + [in whole cluster]
1,759 / 2,730 / + [in contig]
Location1759..2730 [in whole cluster]
1759..2730 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)dTDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)vinB
EC number4.2.1.46
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
MSTRLLVTGAAGFIGSAYVRGLLTDQPDLRVTVLDSLTYAGNRANLDLTHPSLDLVEGDI
CDTELVDRLTAEADQIVHFAAESHVDRSITGSAEFIRTNVLGTHTLLDAALRHGIDRFVH
ISTDEVYGSIEKGSWPETDPLRPNSPYSASKASSDLLALAYHRTHGLDVRVTRCSNNYGP
YQHPEKVIPLFVTNLLDGKRVPLYGDGQNVRDWLHVEDHCAAIECVRTRGGAGEIYNIGG
GTELSNRELTGLLLEACGADWDSVEYVTDRKGHDLRYSVDWSKVADLGYTPAHDFRAGLA
ETVDWYRSNRTWWEPAKYGHSPA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
ATGAGCACCCGACTGCTCGTCACGGGCGCCGCCGGATTCATCGGATCGGCCTACGTCCGC
GGACTCCTCACCGACCAGCCCGACCTGCGGGTCACCGTCCTCGACAGCCTCACCTACGCG
GGCAACCGGGCCAACCTCGACCTGACACACCCCTCCCTCGACCTCGTCGAGGGTGACATC
TGCGACACCGAGCTCGTGGACCGCCTCACCGCCGAAGCCGACCAGATCGTCCACTTCGCC
GCCGAGAGCCACGTCGACCGGTCCATCACCGGCTCCGCCGAGTTCATCCGCACCAACGTC
CTCGGCACCCACACCCTCCTCGACGCCGCGCTCCGCCACGGCATCGACCGGTTCGTCCAC
ATCTCCACGGACGAGGTCTACGGATCGATCGAGAAGGGCTCCTGGCCGGAGACCGACCCG
CTGCGCCCCAACTCCCCCTACTCGGCGTCCAAGGCATCCAGCGACCTCCTGGCGCTCGCC
TACCACCGGACCCACGGGCTCGACGTACGGGTCACCCGTTGCTCCAACAACTATGGCCCC
TACCAGCATCCCGAGAAGGTCATCCCGCTCTTCGTCACCAACCTCCTCGACGGCAAGCGG
GTACCCCTGTACGGGGACGGCCAGAACGTCCGCGACTGGCTGCACGTCGAGGACCACTGC
GCCGCCATCGAATGCGTCCGCACCCGCGGTGGCGCCGGGGAGATCTACAACATCGGCGGC
GGCACCGAACTGAGCAACCGGGAACTCACCGGCCTGCTCCTGGAGGCGTGCGGGGCGGAC
TGGGACAGCGTGGAGTACGTCACCGACCGCAAGGGCCACGACCTGCGCTACTCCGTCGAC
TGGTCCAAGGTCGCCGACCTCGGCTACACCCCCGCCCACGACTTCCGTGCCGGGCTCGCG
GAGACCGTCGACTGGTACCGCTCCAACCGCACCTGGTGGGAACCGGCGAAGTACGGCCAC
AGCCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-239]  1.29999999999998e-69 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [4-315]  TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [4-195]  3.19999999999996e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-19]  0.927 Signal
Bacteria, Gram-negative   
 [1-21]  0.953 Signal
Eukaryota   
TMHMM No significant hit