close all open/close all

CDS information : Vicen_00040


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction2,790 / 4,049 / + [in whole cluster]
2,790 / 4,049 / + [in contig]
Location2790..4049 [in whole cluster]
2790..4049 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)vinC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[17388594] Substrate flexibility of vicenisaminyltransferase VinC involved in the biosynthesis of vicenistatin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRVLMTVFANRSHLYNMVPLAWALTTAGHEVHIASHPDNVQAISDSGLTAVPVGNDLNIM
ALAQSTPREEMVNGGALTLNETRPEKLTWQYIHDVFAQYSQIYEYMADSTMTADLVAHAR
QWQPDLVIWDALTYAGPIAAEAVGAPHVRMLFGLDQWGRMRDHFNRLTGERAADDRHDPL
ADWLATKGEPHGVAFTESLVTGTTTLAVAPPWMSFPSEQPALSMRHLPFNGPAVLPDWLR
EAPSRPRVCLTLGLTLRELADDNVTLADFVNAVADIDADVVATFSAEQVAEIGDLPDNVR
AVDFVPLHALLPSCAAIVHHGGGGTRTNAIRYGVPQLIVPNWLWDEGYVAERFAERGAAL
VTEVPDLTPDRLRDQLRRLIAEPSFKAAAEQIQKEYDALPSLTETVGELVRVAERGRSL
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCGTCCTGATGACGGTGTTCGCCAACCGCTCCCACCTCTACAACATGGTGCCCCTC
GCCTGGGCCCTGACCACCGCGGGCCACGAGGTCCACATCGCCAGCCACCCCGACAACGTG
CAGGCGATCAGCGACAGCGGCCTCACCGCCGTACCCGTCGGCAACGACCTCAACATCATG
GCGCTGGCGCAGTCCACCCCGCGCGAGGAGATGGTCAACGGCGGCGCGCTCACCCTCAAC
GAGACCCGGCCCGAGAAGCTGACCTGGCAGTACATCCACGACGTGTTCGCGCAGTACTCC
CAGATATACGAGTACATGGCGGACTCGACCATGACCGCCGACCTGGTCGCCCACGCCCGC
CAGTGGCAGCCCGACCTCGTCATCTGGGACGCCCTCACCTACGCCGGCCCCATCGCCGCC
GAAGCCGTCGGCGCACCGCACGTCCGGATGCTCTTCGGCCTCGACCAGTGGGGCCGGATG
CGCGACCACTTCAACCGGCTCACCGGGGAACGCGCCGCCGACGACCGCCACGACCCGCTC
GCCGACTGGCTCGCAACCAAGGGCGAGCCGCACGGAGTGGCCTTCACCGAATCCCTCGTC
ACCGGCACGACCACCCTCGCGGTCGCCCCGCCGTGGATGTCGTTCCCCAGCGAGCAGCCC
GCCCTCTCCATGCGGCACCTCCCCTTCAACGGGCCCGCCGTGCTCCCCGACTGGCTCCGC
GAGGCCCCCAGCAGGCCGCGCGTCTGCCTCACCCTCGGGCTGACCCTGCGTGAACTCGCC
GACGACAACGTCACCCTCGCCGACTTCGTCAACGCCGTCGCCGACATCGACGCCGACGTC
GTGGCGACCTTCTCCGCGGAACAGGTCGCCGAGATCGGCGACCTGCCCGACAACGTCCGC
GCGGTGGACTTCGTACCCCTACACGCCCTGCTGCCGAGCTGCGCCGCGATCGTCCACCAC
GGCGGCGGCGGCACCCGCACCAACGCCATCCGGTACGGGGTGCCCCAGCTGATCGTCCCC
AACTGGCTCTGGGACGAGGGGTATGTGGCCGAGCGCTTCGCCGAGCGTGGCGCGGCACTC
GTCACCGAGGTCCCCGACCTCACCCCCGACCGGCTGCGCGACCAGCTCCGCAGGCTCATC
GCCGAGCCGTCCTTCAAGGCGGCGGCGGAGCAGATCCAGAAGGAGTACGACGCGCTGCCC
AGCCTCACCGAGACCGTCGGTGAGCTGGTGCGCGTCGCGGAGCGCGGGCGCTCCCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-147]  1.5e-13 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [208-300]  6.60000000000002e-29 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.621 Signal
Bacteria, Gram-negative   
 [1-23]  0.529 Signal
Bacteria, Gram-positive   
 [1-28]  0.567 Signal
Eukaryota   
TMHMM No significant hit