close all open/close all

CDS information : Vicen_00050


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction4,412 / 11,194 / + [in whole cluster]
4,412 / 11,194 / + [in contig]
Location4412..11194 [in whole cluster]
4412..11194 [in contig]
TypeCDS
Length6,783 bp (2,260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 4
Gene
Gene (GenBank)vinP2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
KS34..409
AT593..926
DH975..1139
ER1483..1797
KR1807..1987
ACP2092..2162

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 4]
MENEKKLLDYLKRATTDLREARRRLREMEEKDQEPIAIVGIGCRFPRGVESAEQLWDLVA
DGGEALTPFPEDRGWDTDSLYHPDPEHLGTSYTNVGAFLHDAAEFDPGFFGISPREALAM
DPQQRLLLETSWEAMERAGIDPAGLRGSRTGVFTGLMYFDYGSRVHSAPEDIEGYLGNGS
AGSIASGRVAYTFGFEGPAVTLDTACSSSLVAIHLAAQSLRKGECTLALAGGASVMSTPD
IFVDFSRQRGLSADGRCKAFSSDADGTGWGEGVGVLLLERLSDARKNGHRILGLVRGSAV
NQDGASSGLTAPNGPSQQRVIRQALANAGLSAAEVDAVEAHGTGTKLGDPIEAQALLATY
GQEREEGRPLWLGSIKSNVGHTQAAAGVAGVIKMVLAMRAGVLPKTLHVSEPSPHVDWSA
GAVELLTETRDWPETGRPRRAGVSSFGISGTNAHVIVEQAPMDEAMDEVAGERETPAAGS
DRTVPWVISAKSADALRAQAGRLSTFLAGTEGTLTTGISSETSVAAVSADASAVGWSLVR
GRSVFAHRAVVVGGEWDALLASIGELADGAEDGSGAASGSVVSGVADVSGRRVFVFPGQG
SQWVGMAQGLLDSSVMFTERMTECAAALDPLVEWSLLDVVRGVEGAASLERVDVVQPVLW
AVMVSLASVWRSVGVVPDAVVGHSQGEIAAAVVGGWLSLVDGARVVALRSLAIREVLAGG
GGMVAVQAAEDEVAGWLEGVEGVGIAAVNGPRSVVISGTRAGLDACVELWSGRGTWVKRV
PVDYASHSAEVERVRERVLADLASVTGLSGSVPMLSTMTGDWIVEGQVGAGYWVENLRRP
VLFADATRRLASEGFGAFVEVSAHPVLVMGIEETIEALRSGAADGAKSGAGEESSSAVVA
VGTLRRGEGGWDQFLRSLAGLFVRGAVTPDWESLLGGVRPRVDLPTYAFQRERLWLDAGV
VAGDVSGLGQVVVGHPLLGAGVGVAGEGGGVLFTGRLGLGSHPWLGDHAVSGVVLLPGAA
FVELVVRAGDEVGCGRLEELTLAAPLVVPERGSVRIQVVVGAGDGSGARSVGVWSSVGDE
GVGGEWVCHASGLLTADVGVAPVLGGVWPPVGGVAVDVSGVYEGLALEGYEYGSVFRGLR
SVWRRGDEVFAEVALGEGVGVEGFGLHPALLDAALQAAGFGSFVPESEAGSEAGSGGVRL
PFSWSGVSLFASGASVGRVRLWPVGGDGFGVELFDGVGMPVARVDALVTREISAGQLGAA
AGAGSLVGGESLFRVEWAPVSGVAPASAGVGGCVVVGAGSVLSGFGEVVPDLAAVSAGSA
AVPGWVLVDVDAWLGADLAVGVVSGEGVPVVARGVVARVLGLVREWLGDERWVSSRLVWV
TRGAVGARVLDEVSGVVSSGLWGLVRAAQSEHPDRFALLDLDSATAVDAVRDGVLGLLAA
GEPQLVVREGEVLAARLTPAHTTDALIPLADHAPWRLAKDPGGSLDALTVVPAPDVLEPL
TEGQVRIAVRAAGVNFRDVLMALGMVPARGTQLGGEAAGVVTAVGPGVTGIAVGDRVMGV
FDGPFGPVAVADRRMVSRIPDAWSYTEAATIPLVYLTAYYGLVDLAALQQGQRILVHAAT
GGVGMAAVQLARHFGAEVYGTASPGKWDTLRAMGFDEAHMASSRSLDFEDHFWQTTGGEG
FDVVLNSLAQEYVDASLRLQPRGGRFLEMGKTDIRDADEVAAAHEGVRYEAYDLTVFTSV
DGPGAIPERIQEMLSELLALFDKGVLTPLPVTTWDVRRASAALRHMSQARHTGKIALTVP
RPLDQDGTVLVTGGTGVLGSLLARHLVTEHGVRNLLLVSRRGGDAPGAAELVAELTAAGA
EVSVVACDTADRAALEKLLASVPGDAPLTGVFHTAGVLDDGIVEAMTPERVDAVMRPKVD
AAWHLHELTEGLDLAAFVLYSSAAGVSGDAGQSNYAAANVFLDALAQRRRAAGLPGQSLA
WGLWDDRSEMTGHLGDAEIARMTEAGVLGFTAADGLAALDRAAMYDDAVLVPMKLDTATL
GAGSSPVPHLFRGLVRTPVVRRAVAGNTGGDSGGGLEQRLAALTAAERTETVLELVRERV
AAVLGHASADAIDPARAFKEIGFDSLTAVELRNRLNAATGLRLPATLVFDYPTPTVLSQY
LLAELAPGLPAEDPVGTRLLEQIARIEAVLSEVSEVTDETSSLSDMDADARSGITARLND
ILTAWNRAQRAPGHDAVAAELDDASDDEIFDFIDSTFGKS
selected fasta
>polyketide synthase [polyketide synthase modules 4]
GTGGAGAACGAAAAGAAACTTCTCGATTACCTCAAGCGGGCTACCACGGACCTACGTGAA
GCACGCCGCCGCCTCCGCGAGATGGAGGAAAAGGACCAGGAGCCCATCGCCATCGTCGGC
ATCGGCTGCCGCTTTCCCCGCGGTGTCGAGTCGGCGGAGCAGCTCTGGGACCTCGTCGCC
GATGGCGGCGAGGCGCTCACCCCGTTCCCCGAGGACCGGGGCTGGGACACCGACAGCCTG
TACCACCCCGACCCGGAGCACCTGGGCACCAGCTACACCAACGTCGGGGCCTTCCTGCAC
GACGCCGCCGAGTTCGACCCCGGCTTCTTCGGGATCTCGCCGCGCGAGGCCCTCGCCATG
GACCCGCAGCAGCGACTGCTGCTTGAGACGTCCTGGGAGGCCATGGAGCGGGCGGGCATC
GACCCGGCCGGCCTGCGCGGCAGCCGCACCGGTGTCTTCACGGGTCTGATGTACTTCGAC
TACGGGTCCCGGGTGCACTCCGCCCCCGAGGACATCGAGGGCTACCTCGGCAACGGCAGC
GCGGGCAGCATCGCGTCCGGCCGGGTCGCCTACACCTTCGGCTTCGAGGGCCCCGCCGTC
ACACTCGACACCGCCTGCTCGTCGTCCCTGGTCGCCATCCACCTCGCCGCGCAGTCCCTG
CGCAAGGGCGAGTGCACCCTGGCGCTGGCCGGTGGCGCGTCGGTGATGTCGACGCCGGAC
ATCTTCGTTGACTTCAGCCGCCAGCGGGGTCTGTCCGCCGACGGCCGGTGCAAGGCGTTC
TCGTCCGACGCGGACGGTACGGGCTGGGGCGAGGGCGTCGGTGTCCTGCTGCTGGAGCGG
TTGTCGGACGCGCGGAAGAACGGGCACCGGATCCTGGGCCTGGTACGCGGCTCCGCCGTC
AACCAGGACGGCGCCAGCAGCGGTCTGACGGCGCCGAACGGTCCTTCGCAGCAGCGGGTG
ATCCGCCAGGCGCTGGCCAACGCCGGTCTGTCGGCCGCCGAGGTGGACGCGGTCGAGGCG
CACGGTACGGGTACGAAGCTGGGTGACCCGATCGAGGCGCAGGCGCTGCTGGCGACCTAC
GGCCAGGAGCGGGAAGAGGGCCGGCCGCTCTGGCTCGGTTCGATCAAGTCGAATGTGGGT
CACACGCAGGCTGCCGCGGGTGTCGCCGGTGTGATCAAGATGGTGCTCGCGATGCGGGCC
GGTGTGCTGCCGAAGACGCTGCATGTGTCGGAGCCGTCGCCGCACGTGGACTGGTCCGCC
GGCGCGGTGGAACTGCTGACGGAGACGCGCGACTGGCCGGAGACCGGCCGTCCGCGCCGC
GCCGGTGTGTCGTCGTTCGGTATCAGTGGCACGAACGCGCACGTCATCGTGGAGCAGGCG
CCCATGGACGAGGCGATGGACGAGGTGGCCGGCGAGCGGGAGACCCCTGCCGCGGGGTCG
GACCGGACCGTCCCGTGGGTCATATCGGCGAAGTCCGCCGACGCGCTCCGCGCACAGGCC
GGACGGCTGAGCACCTTCCTCGCCGGGACCGAGGGAACTCTGACTACTGGTATTTCTTCC
GAAACTTCTGTGGCCGCTGTTTCAGCGGATGCGTCCGCGGTTGGTTGGTCGTTGGTGCGG
GGTCGTTCGGTGTTCGCGCATCGGGCGGTTGTGGTGGGTGGTGAGTGGGACGCGCTGCTG
GCGAGTATCGGTGAACTGGCCGATGGCGCCGAGGATGGTTCCGGTGCTGCCTCTGGTTCT
GTTGTGTCGGGTGTGGCGGATGTGTCGGGGCGTCGGGTGTTTGTGTTCCCGGGGCAGGGT
TCGCAGTGGGTTGGTATGGCGCAGGGGTTGTTGGATTCGTCGGTGATGTTCACGGAGCGG
ATGACGGAGTGTGCTGCGGCGTTGGATCCGTTGGTGGAGTGGTCGTTGTTGGATGTGGTG
CGGGGTGTGGAGGGTGCGGCGTCGTTGGAGCGGGTGGATGTGGTGCAGCCGGTGTTGTGG
GCGGTGATGGTGTCGTTGGCGTCGGTGTGGCGTTCGGTGGGTGTGGTGCCGGATGCGGTG
GTGGGTCATTCGCAGGGTGAGATCGCGGCTGCTGTGGTGGGTGGTTGGTTGTCGTTGGTG
GATGGTGCGCGGGTGGTGGCGTTGCGGTCGTTGGCGATTCGTGAGGTGTTGGCGGGTGGT
GGTGGCATGGTCGCGGTCCAGGCTGCGGAGGATGAGGTTGCTGGGTGGCTTGAGGGTGTG
GAGGGGGTGGGGATTGCTGCGGTGAATGGTCCGCGTTCGGTGGTGATCTCGGGTACGCGT
GCGGGTTTGGATGCGTGTGTGGAGTTGTGGTCTGGGCGGGGGACGTGGGTGAAGCGGGTT
CCGGTGGACTATGCCTCGCATTCGGCTGAGGTGGAGCGGGTGCGTGAGCGGGTGCTGGCG
GATCTGGCGAGTGTGACGGGTTTGTCGGGGTCGGTGCCGATGTTGTCGACGATGACGGGT
GACTGGATTGTTGAGGGTCAGGTTGGGGCCGGGTATTGGGTGGAGAATCTGCGTCGTCCG
GTGTTGTTCGCGGACGCGACGAGGCGGTTGGCGTCGGAGGGTTTCGGCGCGTTCGTTGAG
GTGAGTGCGCATCCGGTCCTGGTCATGGGCATCGAGGAGACGATCGAGGCGCTGAGGTCG
GGTGCCGCCGATGGTGCGAAGTCCGGTGCTGGTGAGGAGAGTTCCTCCGCTGTGGTGGCG
GTGGGGACGTTGCGTCGTGGTGAGGGTGGTTGGGATCAGTTCCTGCGTTCCCTCGCGGGG
CTCTTCGTCCGGGGTGCGGTGACACCGGATTGGGAGTCGTTGTTGGGTGGTGTGCGTCCT
CGGGTTGATTTGCCGACGTATGCGTTCCAGCGTGAGCGGTTGTGGCTGGATGCGGGTGTG
GTGGCGGGGGATGTGTCGGGGTTGGGTCAGGTGGTGGTGGGTCATCCGTTGTTGGGTGCT
GGTGTGGGTGTTGCTGGTGAGGGTGGGGGTGTGTTGTTTACGGGTCGTTTGGGGTTGGGT
TCGCATCCGTGGCTGGGTGATCATGCGGTGTCGGGTGTGGTGTTGTTGCCGGGGGCTGCG
TTTGTGGAGTTGGTGGTGCGTGCGGGTGATGAGGTGGGGTGTGGTCGGTTGGAGGAGTTG
ACGTTGGCGGCTCCGTTGGTGGTGCCGGAGCGTGGTTCGGTGCGGATTCAGGTGGTGGTG
GGTGCTGGTGATGGGTCGGGTGCGCGTTCGGTGGGTGTGTGGTCGTCGGTGGGGGATGAG
GGTGTGGGTGGGGAGTGGGTGTGTCATGCGTCGGGTTTGTTGACGGCTGATGTGGGTGTG
GCGCCGGTGTTGGGTGGTGTGTGGCCGCCGGTGGGTGGTGTGGCGGTGGATGTGTCGGGT
GTGTATGAGGGGTTGGCGTTGGAGGGGTATGAGTATGGGTCGGTGTTTCGGGGGTTGAGG
TCGGTGTGGCGTCGTGGGGATGAGGTTTTTGCTGAGGTGGCGTTGGGTGAGGGTGTGGGG
GTGGAGGGGTTTGGTTTGCATCCGGCGTTGTTGGATGCGGCGTTGCAGGCTGCTGGGTTT
GGTTCGTTTGTGCCGGAGTCCGAGGCAGGGTCTGAGGCGGGTTCGGGTGGGGTGCGGTTG
CCGTTCTCGTGGTCGGGTGTGTCGTTGTTTGCGTCGGGTGCTTCGGTGGGGCGGGTGCGG
TTGTGGCCGGTGGGTGGGGATGGTTTTGGTGTGGAGTTGTTTGATGGGGTGGGGATGCCG
GTGGCGCGGGTGGATGCGTTGGTGACGCGGGAGATTAGTGCGGGTCAGTTGGGTGCGGCT
GCTGGTGCCGGGTCGTTGGTGGGTGGGGAGTCGTTGTTCCGGGTGGAGTGGGCTCCTGTG
TCGGGTGTTGCACCGGCTTCTGCTGGTGTGGGTGGTTGTGTGGTGGTGGGTGCGGGGAGT
GTGTTGTCTGGTTTTGGGGAGGTGGTTCCGGATCTGGCGGCGGTTTCCGCGGGTTCTGCG
GCTGTGCCGGGGTGGGTGTTGGTGGATGTGGATGCGTGGTTGGGTGCGGATCTGGCGGTG
GGTGTGGTGTCGGGTGAGGGTGTTCCGGTGGTGGCGCGTGGTGTGGTGGCGCGGGTGTTG
GGGTTGGTGCGGGAGTGGTTGGGGGATGAGCGGTGGGTGTCGTCGCGGTTGGTGTGGGTG
ACGCGTGGTGCGGTGGGTGCTCGGGTGTTGGATGAGGTGTCGGGTGTGGTGTCGTCGGGG
TTGTGGGGGTTGGTGCGGGCTGCTCAGTCGGAGCATCCGGACCGGTTCGCGCTTCTTGAT
CTGGACAGTGCCACCGCCGTGGATGCCGTTCGTGATGGTGTGTTGGGGTTGTTGGCTGCT
GGTGAGCCGCAGTTGGTGGTGCGTGAGGGTGAGGTGCTGGCCGCACGGCTGACCCCCGCC
CACACCACCGACGCCCTGATCCCCCTCGCCGACCACGCCCCGTGGCGCCTCGCCAAGGAC
CCCGGTGGCAGCCTTGACGCGCTGACGGTCGTCCCGGCCCCCGACGTACTGGAGCCGCTC
ACCGAGGGACAGGTCCGCATCGCGGTCCGCGCCGCCGGGGTGAACTTCCGTGACGTACTC
ATGGCACTCGGCATGGTCCCCGCCCGGGGTACCCAGCTCGGTGGCGAGGCCGCCGGCGTC
GTGACCGCTGTCGGCCCTGGAGTCACCGGGATCGCCGTCGGCGACCGCGTGATGGGCGTC
TTCGACGGCCCGTTCGGCCCGGTGGCCGTCGCGGATCGGCGCATGGTCTCCCGTATCCCC
GATGCCTGGTCGTACACCGAGGCCGCGACGATCCCGCTGGTGTACCTCACCGCGTACTAC
GGACTGGTGGACCTCGCCGCTCTCCAGCAGGGACAGCGCATCCTGGTGCACGCCGCCACC
GGTGGCGTGGGCATGGCAGCGGTCCAGCTCGCCCGCCACTTCGGCGCCGAGGTGTACGGC
ACGGCCAGCCCCGGCAAGTGGGACACCCTGCGCGCGATGGGATTCGACGAGGCGCATATG
GCCTCCTCGCGGTCCCTCGACTTCGAGGACCACTTCTGGCAGACGACGGGTGGCGAAGGC
TTCGACGTCGTACTCAACTCCCTCGCGCAGGAGTACGTGGATGCTTCACTGCGGCTCCAG
CCGCGCGGCGGCCGATTCCTGGAGATGGGTAAGACCGATATCCGGGACGCCGATGAGGTC
GCGGCGGCACACGAGGGAGTGCGCTATGAGGCGTACGACCTCACCGTCTTCACCAGCGTC
GACGGACCGGGCGCGATCCCCGAGCGCATTCAGGAGATGCTCTCCGAACTGCTTGCGCTG
TTCGACAAGGGAGTCCTCACCCCGCTGCCCGTCACCACCTGGGACGTCCGCCGCGCGTCC
GCCGCGCTGCGGCACATGTCGCAGGCCCGGCACACCGGCAAGATCGCGCTGACGGTGCCG
CGCCCGCTCGACCAGGACGGCACGGTCCTCGTCACCGGTGGCACCGGTGTCCTGGGCAGT
CTCCTGGCCCGTCATCTGGTGACCGAGCACGGGGTACGGAATCTGCTGCTGGTGAGCCGT
CGGGGCGGCGACGCCCCCGGCGCCGCCGAACTGGTCGCCGAGCTGACGGCAGCCGGTGCC
GAGGTGAGCGTCGTCGCCTGTGACACCGCCGACCGGGCAGCGTTGGAGAAGCTCCTCGCG
TCCGTGCCGGGTGACGCCCCGCTGACGGGCGTCTTCCACACGGCGGGCGTGCTGGACGAC
GGAATCGTCGAGGCGATGACCCCGGAGCGGGTGGACGCCGTGATGCGCCCCAAGGTGGAC
GCGGCCTGGCATCTGCACGAGCTGACCGAGGGACTTGATCTCGCGGCCTTCGTGCTCTAC
TCCTCCGCAGCCGGTGTCTCCGGTGACGCGGGCCAGTCCAACTACGCCGCCGCCAATGTC
TTCCTCGACGCCCTCGCACAGCGGCGGCGGGCTGCCGGGCTGCCCGGCCAGTCCCTCGCC
TGGGGCCTGTGGGACGACCGGAGCGAGATGACCGGTCACCTCGGCGACGCCGAGATCGCC
CGGATGACCGAGGCCGGTGTCCTCGGCTTCACCGCCGCCGACGGCCTGGCCGCGCTGGAC
CGCGCGGCGATGTACGACGACGCCGTGCTGGTGCCGATGAAGCTGGACACGGCGACCCTG
GGCGCGGGCTCGTCGCCCGTACCGCATCTCTTCCGCGGTCTGGTGCGGACCCCCGTCGTA
CGCCGGGCCGTCGCCGGGAACACCGGCGGGGACAGCGGCGGCGGACTTGAGCAGCGGCTC
GCCGCTCTCACCGCGGCCGAGCGCACCGAGACCGTGCTGGAACTCGTACGGGAGCGCGTC
GCCGCGGTCCTCGGACATGCCAGCGCCGACGCCATCGATCCCGCCCGGGCGTTCAAGGAG
ATCGGGTTCGACTCGCTCACGGCTGTCGAACTGCGGAACAGGCTGAACGCGGCCACCGGA
CTGCGGCTGCCCGCCACACTGGTCTTCGACTATCCGACGCCCACGGTGCTCTCGCAGTAC
CTCCTGGCGGAGCTGGCACCCGGCTTGCCGGCCGAGGACCCGGTCGGGACCCGGCTGCTG
GAGCAGATCGCCCGTATCGAAGCGGTCCTCTCCGAGGTCTCGGAGGTCACGGACGAGACC
TCCTCCCTCTCCGACATGGACGCCGATGCCCGATCGGGCATCACCGCACGCCTCAACGAC
ATCCTGACCGCATGGAACAGGGCCCAGCGCGCGCCGGGTCACGACGCGGTCGCGGCGGAA
CTGGACGACGCCAGCGACGACGAAATCTTCGATTTCATCGACAGCACCTTCGGCAAGTCC
TGA
[4] KS34..409
[4] AT593..926
[4] methylmalonyl-CoA784..788
[4] DH975..1139
[4] ER1483..1797
[4] KR1807..1987
[4] ACP2092..2162
[4] KS100..1227
[4] AT1777..2778
[4] methylmalonyl-CoA2350..2364
[4] DH2923..3417
[4] ER4447..5391
[4] KR5419..5961
[4] ACP6274..6486

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [588-716]  3.7e-64 G3DSA:3.40.366.10 [784-917]  3.7e-64 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2120-2135]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2083-2168]  1.79999754022375e-23 SSF47336
SSF47336   ACP_like
 [2092-2162]  PS50075
PS50075   ACP_DOMAIN
 [2095-2161]  2.2e-12 PF00550
PF00550   PP-binding
 [2090-2166]  1e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1497-1629]  1e-29 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1622-1741]  7.29999999999998e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1503-1559]  6.50000000000001e-09 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1807-1986]  4.10000000000004e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  5.80000000000004e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-409]  3.7e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [593-926]  4.2e-92 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.2e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [591-878]  3.1999989904635e-57 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [719-783]  2.90000354677981e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  1.69999999999998e-91 G3DSA:3.40.47.10 [297-462]  3.30000000000002e-67 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  2.59998233910302e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1575-1772]  3.5e-48 G3DSA:3.40.50.720 [1806-1986]  1.40000000000001e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [595-908]  4.10001399699315e-104 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2093-2165]  2.60000517657733e-37 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [975-1139]  1.69998802370953e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1807-1987]  1.10000150671643e-62 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1483-1797]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit