close all open/close all

CDS information : Vicen_00060


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction11,260 / 21,348 / + [in whole cluster]
11,260 / 21,348 / + [in contig]
Location11260..21348 [in whole cluster]
11260..21348 [in contig]
TypeCDS
Length10,089 bp (3,362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 5-6
Gene
Gene (GenBank)vinP3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 methylmalonyl-CoA
KS33..409
AT565..882
DH928..1091
KR1369..1547
ACP1654..1724
KS1748..2109
AT2273..2601
KR2916..3097
ACP3203..3273

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 5-6]
MANEAKLREYLKRVTTDLHETNERLREVEGRANEPIAIVGMSCRFPGGVESPEQLWELFR
TGTDAIGEFPEGRGWDVEGLYHPDPDHAGTSYTREGGFVHGAERFDPSLFGISPREAVSM
DPQQRLLLETSWEALEASGLDPLRLKGSRTGVFVGVMSSDYGIQKGSAPDGVEGFLSTGT
HSSIVSGRVSYVLGLEGPAVSVDTACSSSLVALHSAAHALRQGECSLALAGGVTIMSTPE
RFVEFSRQRALSADGRCKAFSASADGTGWSEGVGMLVLERLSDARKNGHRVLAVIRGSAL
NQDGASNGLTAPNGPSQQRVIRQALASAGLTAAEVDAVEAHGTGTTLGDPIEAQALLATY
GKEREDGRPLLLGSSKSNLGHTQAAAGVAGVIKMVLAMRAGVLPKTLHVSEPSPHVDWSA
GAVELLTEAREWPETGRPRRAGVSSFGFSGTNAHVIIEEASEFEPSAVEPLAGSGVTPPW
VLSARSADALRGQAERLLSFVSAAGDVSVVDVAYSLGVSRAGLEHRGVVVGESRAELLAA
LESLASGVESPGVVTGRVAEGRLAFLFTGQGAQRVGMGRELAAAFPLFAASLEETCGLLE
RAGVAVREVLFAEEGSAEAALLTRTVYAQAALFAVEVALFRLVESFGVVPDFVAGHSVGE
IAAAHVAGVFSLEDAVSLVAARGRLMDALPEGGAMVAVQATEEDVLALLEGVEDASIAAI
NGPDAVVVSGTEAGVARVVDVLRERGAKTKRLVVSHAFHSPLMEPMLAEFATVVEGLSFA
APTIPVVSNVSGAVADAELSSPGYWVRHVREAVRFGAGVETLLGAGVSSFLEIGPDGVLS
GMARTSVPEGADVECAPLMRRGRGEVREFLTGLSRMVVRGVPVDWQSLVEGGRLAGLPTY
AFQRERFWLDVPSAVGDVATAGLAPSGHPLLGAVMRRADVDGVVFTGRWSLRSHPWLGEH
RVGSSVVFPGTGFVELLMRAGDEVGCGRIEELNQETPLVVPERGALQLQVVVGAPEETGL
RGVGVYSRAEDADADVPWTRHASGLLSPAVVPADFELTQWPPAGAEALNVEDTYQRLADA
GLVYGERFQGLKSGWIKGEDIYAEIALPEHAVAEAAEYTLHPAALDAALQASGLNDPPEV
QATAYVPFSWSGVSLFASGASVLRVCVRHVARDRVSLLVADGVGVPVAVVESLVLRAISA
GAVAVAGVGSGVGGGLFEVVWSPVVGVRGVDVSGVVVLEAGVGVGGDGVSVVGGVLEGLQ
GVLGGGSGSRVVVVTRGAVGSGGVVDVSGAGVWGLVRSVQAEHPGRLVLVDVGVEGDVGV
GVGLALGSGEEQVVVRGGEVFVPRLARVGAVAADAGVDGAEIAGGLGDGVVLVTGGTGGL
GALVARHVVVERGVRRLVLVSRRGLGAPGAVGLVAELEGLGAVVEVVACDVSDRVALAGV
VGGIGSDLSAVVHTAGVVDDGVVESMSVGRVASVFGPKADAAWFLHELTRDMGLSAFVLF
SSMAGTVGGGGQSNYAAANAYLDGLAEYRRGLGLAATSLAWGLWEESTGMGSRLTDADLD
RMSRSGIRTLSIEDGLALFDAALAADRPTVMPAHFDIPALRGQGESLAPVFRTLAGPPAR
RSAAVTPRDIAAATESSLTDRLAGLDAEGRRALVLGVVRAQVAQVLAYASPDLVEPERAF
QDLGFDSLTAVELRNGLTAIAGVRLPATLVFDYPSTDILTDFLLAELSDEIPAAVATLPA
MGHVVDDDPIAVIGMGCRYPGGVESPEELWKLMAEGRDAISEFPTDRGWDLDAIYHPDPM
HTGTSYTREGGFIHNAGDFDAAFFGISPREAMETDPQQRLLLETSWEAFEQAGIVPTDLK
GTQTGVFAGVMYHDYAGNIGSGSIVTGRVAYTLGLEGPAVSIDTACSSSLVAIHLAAQSL
RQGECSMAIAGGVAVMATPESFIEFSRQRALSQNGRCRAFSSDADGTAWGEGVGVLILER
LSDARKNGHEVLAVIRGSALNQDGASNGLTAPNGPSQQRVIRQALANSGLSAAEVDAVEA
HGTGTTLGDPIEAQALLATYGKERDADQPLWLGSSKSNFGHTKAAAGVAGVIKMVMAIRN
GVLPKTLHVTEPSPHVDWSAGAVELLAEAREWPETGRPRRAGVSSFGISGTNAHVIVEQA
PTDQAATKPKAADAVPGLPVPWVVSAKNPEALRAQAGRLGSFLGETGVVDVPAVGWSLVR
GRSVFAHRAVVVGGEWDALLASIGELADGAEDGSGAASGSVVSGVADVSGRRVFVFPGQG
SQWVGMAQGLLDSSVVFTERMTECAAALDPLVEWSLLDVVRGVEGAASLERVDVVQPVLW
AVMVSLASVWRSVGVVPDAVVGHSQGEIAAAVVGGWLSLVDGARVVALRSLAIREVLAGG
GGMVAVQAAEDEVAGWLEGVEGVGIAAVNGPRSVVISGTRAGLDACVELWSGRGTWVKRV
PVDYASHSAEVERVRERVLADLASVTGLSGSVPMLSTMTGDWIVEGQVGAGYWVENLRRP
VLFADATRRLASEGFGAFVEVSAHPVLVMGIEETLEAHHTATTDDDTTTRTPVVTVGTLR
RGEGGWDQFLRSLAGLFVRGAVTPDWESLLGGTRPRVDLPTYAFQRRRFWIESVRKEAVT
LAADPVDAAFWEAVESADLAKLADSLRIETDVLEGVLPALTSWRTRSREQSLVDGWRYRE
EWKPVPAPTPNSATGTWTVLVPATHQGDATVTGVLDGLRRGGADIRVLEVTATDREALAE
QLRAELAQSEPRLILSLLALDDRAHPRHPELTEGITATIALVQALDDCGATARLWCATSL
AVAVTESAEVLNPVQTTAWGMGASFALDHPETWGGLVDLPADIDTRTADILCSVLASDLQ
EDQIALRTAGLFARRMVRARLDESAVATEQPWRPNGTVLVTGGTGGIGSHVARWLAAAGA
EHLVLTSRRGAEAPGAAELEAELALLGAKVTLAACDMGDRESVRELVAALPDAAPLTAVF
HLAGALPDGERRLSATTFEDFSRMTRAKIGGAVHLDELLADRELAAFVTFSSGSAIWGNA
NQAAYGASNAFLDGLVHNRRARGLAGTSIAWGLWGGDGTDTETDEQLSRIGVRSMDPRLA
LEVLRQALDQDTSHLIATDIDWQRFAPVFTIARPRPLLDGIAEVRAVLSADTAEVGPADD
DTPKETVVTRLAGLSPAERDHALLELVRTQVAAVLRYSDTSDVEQDQSFKDLGFDSVTAV
ELRNKLTRGVRAAAARHGVFDYATPVALAAHLRSELFTDDAAASGEVPLLAELDRIEAAV
TSLPSADIERMHLTSRLQSLVTKLNDIVGAGAPLEAEAIADKLETATADDIFAFIDKDLG
LN
selected fasta
>polyketide synthase [polyketide synthase modules 5-6]
ATGGCCAACGAAGCCAAGCTCCGCGAATACCTCAAGCGCGTCACCACCGATCTGCACGAG
ACCAATGAGCGCTTGCGCGAGGTCGAGGGCAGGGCGAACGAACCGATCGCGATCGTGGGT
ATGAGCTGCCGCTTCCCCGGGGGTGTCGAGTCCCCGGAGCAGTTGTGGGAGCTGTTCCGT
ACGGGTACGGACGCCATCGGTGAGTTCCCCGAAGGACGCGGCTGGGACGTCGAGGGGCTC
TACCACCCGGACCCCGACCACGCGGGCACCAGCTACACGCGTGAAGGCGGCTTCGTCCAC
GGCGCCGAGCGCTTCGACCCGAGCCTCTTCGGCATCTCGCCGCGCGAGGCCGTGTCGATG
GACCCGCAGCAGCGGCTGCTCCTTGAGACCTCGTGGGAGGCCCTGGAGGCGAGCGGACTC
GACCCGCTCCGCCTCAAGGGCAGCCGCACCGGTGTCTTCGTCGGTGTCATGTCCTCGGAC
TACGGCATTCAGAAGGGCTCGGCGCCCGACGGTGTCGAGGGCTTCCTGAGCACCGGTACG
CACTCCAGCATCGTCTCCGGCCGGGTCTCGTACGTCCTGGGTCTGGAGGGTCCGGCGGTC
TCGGTCGACACCGCTTGCTCGTCCTCGCTCGTCGCCCTGCACTCCGCCGCGCACGCCCTG
CGCCAGGGTGAGTGCTCCCTCGCCCTGGCGGGCGGCGTGACGATCATGTCGACGCCGGAA
CGTTTCGTCGAGTTCAGCCGACAGCGGGCCCTGTCCGCCGACGGCCGCTGCAAGGCGTTC
TCGGCGAGCGCCGACGGCACCGGCTGGTCCGAGGGTGTCGGCATGTTGGTCCTGGAGCGG
CTCTCCGACGCGCGGAAGAACGGGCACCGGGTGCTTGCGGTCATCCGTGGTTCGGCGTTG
AACCAGGATGGTGCGAGCAATGGTCTGACGGCGCCGAACGGTCCGTCCCAGCAGCGGGTG
ATTCGTCAGGCGCTGGCGAGTGCCGGTCTGACGGCGGCCGAGGTGGACGCTGTCGAGGCG
CATGGCACCGGCACCACGCTCGGTGACCCCATTGAGGCGCAGGCACTGCTGGCGACCTAC
GGCAAGGAGCGCGAGGACGGTCGTCCGCTGCTGCTGGGTTCCTCCAAGTCGAACCTCGGC
CACACCCAGGCCGCGGCCGGTGTTGCCGGTGTGATCAAGATGGTGCTCGCGATGCGGGCC
GGTGTGCTGCCGAAGACGCTGCATGTGTCGGAGCCGTCGCCGCACGTGGACTGGTCCGCC
GGCGCGGTGGAGCTACTCACGGAGGCCCGGGAGTGGCCGGAGACCGGCCGTCCGCGCCGC
GCCGGTGTGTCGTCGTTCGGGTTCAGTGGCACGAACGCGCACGTGATCATCGAGGAGGCG
TCGGAGTTCGAGCCGAGCGCCGTGGAGCCGCTGGCCGGGTCGGGCGTGACTCCGCCGTGG
GTGCTGTCGGCGCGGTCGGCCGACGCGTTGCGGGGGCAGGCGGAGCGGCTGCTGTCGTTC
GTCTCTGCCGCCGGTGATGTGTCGGTGGTGGATGTGGCGTACTCGCTGGGTGTGTCGCGT
GCGGGTCTTGAGCATCGTGGTGTGGTGGTGGGGGAGTCGCGTGCGGAGTTGCTCGCGGCT
CTGGAGTCGTTGGCGTCCGGGGTTGAGTCGCCGGGTGTGGTGACGGGTCGGGTCGCTGAG
GGTCGGTTGGCGTTCTTGTTCACGGGGCAGGGTGCGCAGCGGGTTGGTATGGGGCGTGAG
CTGGCTGCTGCGTTCCCGTTGTTTGCGGCGTCTCTTGAGGAGACGTGTGGCTTGTTGGAG
CGTGCCGGGGTTGCGGTGCGTGAGGTGCTGTTCGCCGAGGAGGGTTCGGCCGAGGCCGCC
CTGCTGACGCGGACGGTGTATGCGCAGGCGGCGTTGTTTGCGGTGGAGGTGGCGCTGTTC
CGGTTGGTGGAGTCGTTCGGTGTGGTGCCGGACTTTGTCGCTGGGCATTCGGTGGGTGAG
ATCGCTGCCGCGCATGTCGCGGGGGTGTTCTCGCTTGAGGATGCGGTGTCTCTGGTGGCG
GCTCGTGGTCGGTTGATGGATGCGCTGCCGGAGGGTGGGGCGATGGTGGCGGTGCAGGCC
ACCGAGGAGGATGTGCTCGCTCTGTTGGAGGGGGTGGAGGATGCCTCCATCGCGGCGATC
AATGGCCCCGACGCCGTGGTGGTCTCCGGCACCGAGGCCGGTGTCGCCCGCGTAGTGGAT
GTACTCCGGGAGCGGGGTGCGAAGACCAAGCGGCTCGTGGTGAGTCATGCCTTCCACTCG
CCGCTGATGGAGCCGATGTTGGCTGAGTTCGCCACCGTCGTGGAGGGGTTGTCGTTCGCG
GCTCCCACCATTCCGGTGGTGTCGAATGTGTCGGGTGCGGTGGCGGATGCCGAGTTGTCG
TCGCCGGGTTACTGGGTGCGGCATGTGCGTGAGGCGGTTCGTTTCGGTGCCGGGGTGGAG
ACCCTGCTCGGCGCTGGTGTGTCGTCGTTCCTGGAGATCGGTCCGGACGGTGTGCTGAGC
GGGATGGCCCGCACGTCCGTGCCTGAGGGTGCGGATGTGGAGTGCGCGCCGCTGATGCGC
CGGGGCCGTGGTGAGGTGCGGGAGTTCCTCACCGGCCTCTCCCGGATGGTCGTACGGGGA
GTCCCGGTCGACTGGCAGTCGCTGGTCGAGGGCGGTCGCCTGGCCGGACTGCCGACGTAC
GCCTTCCAGCGTGAGCGGTTCTGGCTGGACGTTCCTTCCGCTGTCGGTGATGTGGCCACC
GCCGGACTTGCGCCCTCGGGCCACCCCCTGCTCGGTGCGGTCATGCGACGCGCCGATGTC
GATGGTGTCGTGTTCACGGGCCGCTGGTCACTGCGCAGTCATCCGTGGCTGGGTGAGCAC
CGGGTCGGGTCTTCGGTGGTGTTCCCGGGGACCGGGTTCGTCGAGCTGCTGATGCGCGCG
GGCGACGAGGTCGGTTGCGGCCGGATCGAGGAGTTGAACCAGGAGACTCCGCTCGTCGTC
CCCGAGCGCGGAGCGCTCCAGCTCCAGGTGGTCGTGGGCGCGCCCGAGGAGACCGGCCTC
CGTGGTGTCGGCGTGTACTCGCGCGCGGAGGACGCCGATGCGGATGTGCCGTGGACCCGG
CACGCCAGTGGTCTGCTGAGCCCGGCCGTGGTGCCGGCCGACTTCGAGCTGACGCAGTGG
CCGCCGGCCGGTGCGGAGGCCCTCAATGTCGAGGACACGTACCAGCGACTCGCTGATGCC
GGACTGGTCTACGGCGAGCGGTTCCAGGGCCTCAAGTCGGGCTGGATCAAGGGTGAGGAC
ATCTACGCCGAGATCGCGCTGCCCGAGCACGCCGTCGCCGAGGCGGCCGAGTACACGCTG
CACCCGGCGGCGCTGGACGCTGCCCTTCAGGCGAGCGGTCTGAACGATCCGCCCGAGGTG
CAGGCGACGGCCTATGTCCCCTTCTCGTGGTCGGGGGTGTCGTTGTTTGCTTCGGGTGCT
TCGGTGTTGCGGGTGTGTGTGCGTCATGTGGCGCGGGATCGGGTGTCGTTGTTGGTGGCT
GATGGTGTGGGTGTGCCGGTTGCGGTGGTGGAGTCGTTGGTGTTGCGGGCGATTTCTGCT
GGTGCGGTGGCGGTTGCTGGGGTGGGTTCGGGTGTGGGTGGTGGGTTGTTTGAGGTGGTG
TGGTCTCCGGTTGTTGGTGTGAGGGGTGTGGATGTGTCGGGTGTGGTGGTGTTGGAGGCT
GGTGTGGGTGTTGGTGGGGATGGGGTTTCGGTGGTGGGTGGTGTGTTGGAGGGTTTGCAG
GGTGTGTTGGGTGGGGGTTCTGGTTCTCGTGTGGTGGTGGTGACGCGGGGTGCGGTTGGT
TCTGGTGGTGTGGTGGATGTGTCGGGTGCGGGTGTGTGGGGGTTGGTGCGGTCGGTTCAG
GCTGAGCATCCGGGTCGGTTGGTGTTGGTGGATGTGGGTGTTGAGGGTGATGTGGGTGTG
GGTGTGGGGTTGGCTTTGGGTTCGGGTGAGGAGCAGGTGGTGGTGCGTGGGGGTGAGGTG
TTTGTTCCTCGTTTGGCGCGGGTGGGTGCTGTGGCGGCGGATGCGGGTGTTGATGGTGCT
GAGATCGCGGGTGGTTTGGGTGATGGTGTGGTGTTGGTGACGGGTGGTACGGGTGGGTTG
GGTGCGTTGGTGGCGCGGCATGTGGTGGTGGAGCGTGGGGTGCGTCGTTTGGTGTTGGTG
TCGCGTCGTGGGTTGGGTGCTCCGGGTGCGGTGGGGTTGGTGGCTGAGTTGGAGGGTTTG
GGTGCTGTGGTGGAGGTGGTGGCGTGTGATGTGAGTGATCGTGTGGCGTTGGCGGGTGTG
GTGGGGGGTATTGGGTCGGATCTTTCGGCTGTGGTGCATACGGCGGGTGTGGTGGATGAC
GGTGTGGTGGAGTCGATGTCGGTGGGTCGGGTGGCGTCGGTGTTTGGTCCGAAGGCGGAT
GCTGCGTGGTTTTTGCATGAGTTGACGCGTGACATGGGGCTGTCGGCGTTTGTGTTGTTC
TCGTCGATGGCGGGGACGGTGGGTGGTGGTGGTCAGAGCAACTATGCGGCGGCGAATGCT
TATTTGGATGGTTTGGCGGAGTATCGGCGTGGGTTGGGGCTGGCGGCGACATCTCTAGCC
TGGGGACTCTGGGAAGAGTCGACGGGCATGGGCAGCCGCCTCACCGACGCCGACCTGGAC
AGGATGAGCCGCTCGGGCATCCGTACGCTCTCGATCGAGGACGGGCTGGCGCTCTTCGAC
GCGGCCCTCGCCGCCGACCGGCCGACAGTCATGCCGGCCCACTTCGACATCCCCGCCCTG
CGGGGACAGGGCGAATCCCTCGCGCCGGTCTTCCGCACCCTGGCCGGCCCCCCGGCCCGC
CGCTCGGCGGCCGTCACCCCCCGTGACATCGCGGCGGCGACCGAGAGCAGCCTCACCGAC
CGGCTCGCCGGTCTGGACGCGGAAGGACGCCGGGCGCTGGTGCTCGGTGTGGTTCGTGCG
CAGGTCGCGCAGGTGCTGGCCTACGCCTCACCGGATCTCGTGGAGCCGGAGCGCGCCTTC
CAGGACCTCGGCTTCGACTCGCTGACCGCCGTCGAACTGCGCAACGGCCTCACGGCCATC
GCGGGAGTCCGCCTCCCGGCGACGCTCGTCTTCGACTACCCCTCGACCGACATCCTCACC
GACTTCCTCCTCGCCGAACTCTCCGACGAGATTCCGGCGGCGGTGGCGACCCTGCCGGCG
ATGGGCCATGTCGTCGACGACGACCCGATCGCCGTCATCGGCATGGGCTGCCGCTACCCC
GGCGGGGTCGAGTCCCCCGAGGAACTGTGGAAGCTCATGGCGGAGGGCCGGGACGCCATC
TCCGAGTTCCCGACCGACCGCGGGTGGGACCTCGATGCCATCTACCACCCCGACCCGATG
CACACGGGCACCAGCTACACCCGCGAGGGTGGCTTCATCCACAACGCGGGCGACTTCGAC
GCCGCCTTCTTCGGGATCTCGCCGCGCGAGGCGATGGAGACCGACCCCCAGCAGCGACTG
CTCCTTGAGACGTCCTGGGAGGCGTTCGAGCAGGCCGGGATCGTCCCCACCGATCTCAAG
GGCACTCAGACCGGTGTCTTCGCCGGTGTCATGTACCACGACTACGCGGGCAACATCGGC
TCCGGCAGCATCGTCACGGGCCGCGTCGCGTACACCCTGGGCCTGGAGGGTCCGGCAGTC
TCCATCGACACCGCCTGCTCGTCGTCCCTGGTCGCCATCCACCTCGCCGCGCAGTCCCTG
CGTCAGGGCGAGTGCTCCATGGCCATCGCCGGAGGTGTCGCCGTCATGGCGACGCCGGAG
TCGTTCATCGAATTCAGCCGCCAGCGCGCGCTCTCCCAGAACGGCCGCTGCCGCGCCTTC
TCCTCGGACGCGGACGGTACGGCCTGGGGCGAGGGTGTCGGTGTCCTGATCCTGGAGCGG
TTGTCGGACGCGCGGAAGAACGGGCACGAGGTACTCGCGGTCATCCGTGGTTCGGCGTTG
AACCAGGATGGTGCGAGCAATGGTCTGACGGCGCCGAACGGTCCGTCCCAGCAGCGGGTG
ATCCGCCAGGCGCTGGCGAACTCGGGTCTGTCGGCCGCCGAGGTGGACGCGGTCGAGGCG
CACGGCACCGGTACCACGCTCGGTGACCCGATCGAGGCGCAGGCACTGCTGGCGACCTAC
GGCAAGGAGCGGGACGCGGACCAGCCCCTCTGGCTCGGTTCGTCCAAGTCGAACTTCGGT
CACACCAAGGCCGCCGCCGGTGTCGCCGGTGTGATCAAGATGGTGATGGCCATCAGGAAC
GGTGTGCTGCCGAAGACGCTGCATGTCACCGAGCCGTCGCCGCACGTGGATTGGTCTGCT
GGTGCGGTGGAGCTGTTGGCGGAGGCTCGGGAGTGGCCTGAGACGGGTCGTCCGCGCCGC
GCCGGTGTGTCGTCCTTCGGTATCAGTGGGACGAACGCGCACGTGATCGTGGAGCAGGCC
CCCACCGACCAGGCCGCTACCAAGCCGAAGGCTGCCGACGCGGTCCCGGGCCTGCCCGTT
CCGTGGGTGGTGTCTGCGAAGAACCCGGAGGCGTTGCGGGCGCAGGCGGGTCGGTTGGGG
TCGTTCTTGGGTGAGACCGGTGTTGTTGATGTGCCGGCGGTGGGTTGGTCGTTGGTGCGG
GGTCGTTCGGTGTTCGCGCATCGGGCGGTTGTGGTGGGTGGTGAGTGGGACGCGCTGCTG
GCGAGTATCGGTGAACTGGCCGATGGCGCCGAGGATGGTTCCGGTGCTGCCTCTGGTTCT
GTTGTGTCGGGTGTGGCGGATGTGTCGGGGCGTCGGGTGTTTGTGTTCCCGGGGCAGGGT
TCGCAGTGGGTTGGTATGGCGCAGGGGTTGTTGGATTCGTCGGTGGTGTTCACGGAGCGG
ATGACGGAGTGTGCTGCGGCGTTGGATCCGTTGGTGGAGTGGTCGTTGTTGGATGTGGTG
CGGGGTGTGGAGGGTGCGGCGTCGTTGGAGCGGGTGGATGTGGTGCAGCCGGTGTTGTGG
GCGGTGATGGTGTCGTTGGCGTCGGTGTGGCGTTCGGTGGGTGTGGTGCCGGATGCGGTG
GTGGGTCATTCGCAGGGTGAGATCGCGGCTGCTGTGGTGGGTGGTTGGTTGTCGTTGGTG
GATGGTGCGCGGGTGGTGGCGTTGCGGTCGTTGGCGATTCGTGAGGTGTTGGCGGGTGGT
GGTGGCATGGTCGCGGTCCAGGCTGCGGAGGATGAGGTTGCTGGGTGGCTTGAGGGTGTG
GAGGGGGTGGGGATTGCTGCGGTGAATGGTCCGCGTTCGGTGGTGATCTCGGGTACGCGT
GCGGGTTTGGATGCGTGTGTGGAGTTGTGGTCTGGGCGGGGGACGTGGGTGAAGCGGGTT
CCGGTGGACTATGCCTCGCATTCGGCTGAGGTGGAGCGGGTGCGTGAGCGGGTGCTGGCG
GATCTGGCGAGTGTGACGGGTTTGTCGGGGTCGGTGCCGATGTTGTCGACGATGACGGGT
GACTGGATTGTTGAGGGTCAGGTTGGGGCCGGGTATTGGGTGGAGAATCTGCGTCGTCCG
GTGTTGTTCGCGGACGCGACGAGGCGGTTGGCGTCGGAGGGTTTCGGCGCGTTCGTTGAG
GTGAGTGCGCATCCGGTCCTGGTCATGGGCATCGAGGAGACCTTGGAGGCCCATCACACC
GCCACGACCGACGACGACACCACCACCCGAACCCCCGTGGTCACCGTCGGCACGTTGCGT
CGTGGTGAGGGTGGTTGGGATCAGTTCCTGCGCTCCCTCGCGGGGCTCTTCGTCCGGGGT
GCGGTGACACCGGATTGGGAGTCGTTGCTGGGCGGTACGCGTCCCCGGGTCGACCTCCCG
ACCTACGCCTTCCAGCGTCGGCGCTTCTGGATCGAGAGCGTCAGGAAGGAAGCGGTGACA
CTCGCCGCCGACCCGGTCGACGCCGCGTTCTGGGAGGCCGTCGAGAGCGCCGACCTGGCG
AAGCTCGCCGACAGCCTGCGCATCGAGACCGACGTACTCGAAGGCGTACTCCCCGCGCTC
ACCTCCTGGCGGACACGCAGCCGTGAGCAGTCGCTCGTCGACGGCTGGCGCTACCGCGAG
GAGTGGAAGCCGGTGCCCGCACCGACCCCGAACAGCGCCACCGGCACCTGGACCGTGCTG
GTCCCGGCCACCCACCAGGGCGACGCCACCGTGACCGGTGTGCTGGACGGCCTGCGCCGT
GGCGGCGCCGACATCCGGGTGCTCGAGGTCACCGCCACCGACCGCGAGGCCCTGGCCGAG
CAGCTCCGCGCCGAACTCGCCCAGAGCGAGCCCCGGCTCATCCTCTCCCTGCTGGCACTG
GACGACCGCGCCCACCCCCGTCACCCCGAGCTGACCGAGGGCATCACCGCCACCATCGCT
CTCGTCCAGGCGCTGGACGACTGCGGCGCCACCGCCCGGCTCTGGTGCGCCACCTCGCTG
GCCGTCGCGGTCACCGAATCGGCCGAGGTGCTCAACCCCGTACAGACGACCGCCTGGGGC
ATGGGCGCGTCCTTCGCGCTCGACCACCCCGAGACCTGGGGCGGACTGGTCGACCTCCCG
GCCGACATCGACACCCGTACCGCGGACATCCTCTGCTCGGTCCTGGCGTCGGACCTCCAG
GAAGACCAGATCGCCCTGCGTACGGCCGGCCTCTTCGCCCGCCGTATGGTCCGGGCCCGC
CTCGACGAATCCGCCGTGGCGACAGAGCAGCCGTGGCGGCCCAACGGCACCGTCCTGGTC
ACCGGAGGCACCGGCGGGATCGGCTCGCACGTGGCGCGCTGGCTGGCGGCCGCCGGTGCG
GAGCACCTCGTACTCACCAGCCGTCGCGGTGCCGAGGCGCCCGGCGCCGCCGAACTCGAA
GCCGAGCTGGCCCTGCTGGGTGCCAAGGTGACCCTCGCCGCCTGTGACATGGGAGACCGC
GAGTCCGTACGGGAACTCGTCGCCGCCCTCCCCGACGCCGCACCGCTCACGGCCGTCTTC
CACCTGGCCGGCGCACTCCCGGACGGCGAGCGCCGACTCTCGGCGACGACGTTCGAGGAC
TTCTCCCGGATGACCCGGGCGAAGATCGGTGGAGCCGTTCACCTGGACGAGCTGCTCGCG
GACCGCGAGCTCGCGGCCTTCGTGACCTTCTCCTCCGGCTCGGCGATCTGGGGCAACGCC
AACCAGGCGGCGTACGGCGCGTCCAACGCGTTCCTCGACGGCCTCGTCCACAACCGGCGG
GCACGTGGGCTCGCCGGGACGTCGATCGCGTGGGGGCTCTGGGGCGGTGACGGCACGGAC
ACCGAGACCGACGAGCAGCTCAGCCGCATCGGTGTCAGGTCGATGGACCCTCGGCTGGCC
CTTGAGGTCCTCCGGCAGGCCCTCGACCAGGACACCAGCCATCTGATCGCCACCGACATC
GACTGGCAGCGCTTCGCCCCGGTGTTCACCATCGCCCGGCCGCGCCCGCTGCTGGACGGA
ATCGCCGAGGTCAGGGCCGTCCTGTCGGCGGACACCGCCGAGGTCGGGCCGGCCGACGAT
GACACCCCGAAGGAGACCGTCGTCACCCGGCTCGCCGGCCTCAGCCCCGCCGAGCGTGAC
CACGCCCTGCTGGAGCTCGTACGGACACAGGTGGCCGCGGTGCTCCGCTACTCGGACACC
TCGGACGTCGAGCAGGACCAGTCCTTCAAGGACCTCGGCTTCGACTCCGTCACCGCGGTC
GAACTGCGGAACAAGCTCACACGCGGCGTCCGCGCTGCGGCTGCCCGCCACGGCGTCTTC
GACTACGCCACCCCGGTCGCCCTCGCGGCCCATCTGCGGTCGGAGCTGTTCACGGACGAC
GCCGCGGCGTCGGGAGAGGTGCCGCTGCTGGCGGAGCTCGACCGGATCGAGGCGGCGGTG
ACCTCGCTCCCGTCGGCCGACATCGAGCGGATGCACCTCACCTCCAGGCTTCAGAGCCTG
GTGACCAAGTTGAACGACATCGTCGGCGCGGGAGCTCCCCTGGAAGCGGAGGCCATCGCG
GACAAGCTCGAAACGGCCACTGCCGATGACATCTTCGCGTTCATCGACAAGGACCTCGGT
CTGAACTGA
[5] KS33..409
[5] AT565..882
[5] malonyl-CoA756..760
[5] DH928..1091
[5] KR1369..1547
[5] ACP1654..1724
[6] KS1748..2109
[6] AT2273..2601
[6] methylmalonyl-CoA2464..2468
[6] KR2916..3097
[6] ACP3203..3273
[5] KS97..1227
[5] AT1693..2646
[5] malonyl-CoA2266..2280
[5] DH2782..3273
[5] KR4105..4641
[5] ACP4960..5172
[6] KS5242..6327
[6] AT6817..7803
[6] methylmalonyl-CoA7390..7404
[6] KR8746..9291
[6] ACP9607..9819

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-689]  G3DSA:3.40.366.10 [756-871]  G3DSA:3.40.366.10 [2268-2396]  G3DSA:3.40.366.10 [2464-2592]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1682-1697]  PS00012 [3231-3246]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1647-1764]  1e-24 SSF47336 [3194-3280]  9.70001793430487e-17 SSF47336
SSF47336   ACP_like
 [1654-1724]  PS50075 [3203-3273]  PS50075
PS50075   ACP_DOMAIN
 [1655-1729]  2.1e-34 G3DSA:1.10.1200.10 [3202-3276]  2.1e-34 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1658-1716]  6.3e-07 PF00550 [3206-3272]  5e-06 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1369-1546]  3.29999999999997e-55 PF08659 [2916-3095]  4.30000000000003e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-284]  4.69999999999992e-98 PF00109 [1748-1984]  6.10000000000004e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  1.6e-46 PF02801 [1992-2109]  3.80000000000003e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-882]  4.5e-62 PF00698 [2273-2601]  1.39999999999997e-92 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-34]  1.69999922284049e-09 SSF101173
SSF101173   Polyketide_synth_docking
 [1-27]  3.3e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-866]  7.60000011115808e-71 SSF52151 [2271-2573]  6.00001679190159e-59 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-755]  1.09999909120787e-16 SSF55048 [2399-2463]  2.90000354677981e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [296-462]  1.79999999999997e-130 G3DSA:3.40.47.10 [1750-1996]  G3DSA:3.40.47.10 [1997-2162]  1.79999999999997e-130 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  6.4999795054176e-104 SSF53901 [1740-2108]  8.89993011983204e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1368-1554]  4.89999999999996e-72 G3DSA:3.40.50.720 [2908-3118]  5.09999999999993e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1897-1913]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-863]  8.39998014024973e-114 SM00827 [2275-2583]  9.49996855930963e-107 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1655-1727]  7.49999605851445e-30 SM00823 [3204-3276]  2.19999900980708e-25 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [928-1091]  2.2999842048857e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1750-2162]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1369-1547]  2.1000026783403e-56 SM00822 [2916-3097]  1.40000506907309e-48 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit