close all open/close all

CDS information : Vicen_00070


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction21,411 / 32,837 / + [in whole cluster]
21,411 / 32,837 / + [in contig]
Location21411..32837 [in whole cluster]
21411..32837 [in contig]
TypeCDS
Length11,427 bp (3,808 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 7-8
Gene
Gene (GenBank)vinP4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

7 malonyl-CoA
8 malonyl-CoA
KS34..409
AT569..886
DH932..1094
KR1380..1558
ACP1664..1734
KS1759..2134
AT2295..2612
DH2658..2824
KR3148..3328
ACP3423..3497
TE3577..3804

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 7-8]
MSNEEKLLDYLKRVTADLHATRQRLREAESDEQEPIAVVAMGCRYPGDVRTPEDLWQLVA
TGGDAVTEFPADRGWDFDTLLGGDAGASGSTYVARGGFVHDAADFDADFFGISPREALAM
DPQQRLLLELAWETSERAGIDPHSLRGASVGVFAGTNGQDYADLMDRAPEDTEAYLSTGS
VAAVVSGRVSYALGLEGPSVSVDTACSSSLVALHLACQALRQKECSMAFAGGVTIMSTPG
PFIAFSRQSGLASDGRCKAFSDDTDGTGWGEGAGLLLLERLSDARRNGHQVLAVVRGSAL
NQDGASNGLTAPNGPSQQRVIRQALANAGLTAAEVDAVEAHGTGTTLGDPIEAQAILATY
GQSREQDQPLWLGSIKSNIGHTQAAAGVSGVIKMVMAIQNGVLPKTLHVSEPSSVVDWSA
GAVELLTEAREWPETGRPRRAGVSSFGVSGTNAHIIMEQAPVPEAESEPDGEAPAAVSGL
PVPWVVSGKTADALRAQAERLLSFVSADADVSVVDVAYSLGVSRAGLEHRGVVVGESRAE
LLAALESLASGVESPGVVTGRVAEGRLAFLFTGQGAQRVGMGRELAAAFPVFAASLEETC
GLLERAGVAVREVLFAEEGSAEAALLTRTVYAQAALFAVEVALFRLVESFGVVPDFVAGH
SVGEIAAAHVAGVFSLEDAVSLVAARGRLMDALPEGGAMVAVQATEEDVLALLEGVEDAS
IAAINGPDAVVVSGTEAGVARVVDVLRERGAKTKRLDVSHAFHSPLMEPMLAEFATVVEG
LSFAAPTIPVVSNVSGAVADAELSSPGYWVRHVREAVRFGAGVETLLGAGVSSFLEIGPD
GVLSGMARGSISDGADVGCVPVMRRGRGEVREFLTGLSRIAVRGVPVSWGPLLAGGRRVE
LPTYAFQRRRFWLEAGHSVTDASGLGQTAAGHPLIGAVVSLAGGDGAVLTGRVSLNTHPW
LGDHRVASSVVFPGTGFVELLMRAGDEVGCGRLEELNQEAPLVVPDRGAVQIQVTVEAPN
AVGERPVAVYSRLEDTDTDAPWTRHASGLLSPTTASADFDFTAWPPAGADPLSVDGMYDR
PDSGLVYGPLFQGLTAAWRKGDEVYAEIELPEGAAVDAARFGMHPALLDAALHALGFSAS
YEDQEEDGTVARLPFSWSGVSLFASGASVLRVCVRHVARDRVSLLVADGVGVPVAVVESL
VLRAISAGAVAVAGVGSGVGGGLFEVVWSPVVGVRGVDVSGVVVLEAGVGVGGDGVSVVG
GVLEGLQGVLGGGSGSRVVVVTRGAVGSGGVVDVSGAGVWGLVRSVQAEHPGRLVLVDVG
VEGDVGVGVGLALGSGEEQVVVRGGEVFVPRLARVSVVAADVVPDAGVDGADIRGGLGDG
VVLVTGGTGGLGALVARHVVVERGVRRLVLVSRRGLGAPGAVGLVAELESLGAVVEVVAC
DVSDRVALAGVVGGIGSDLSAVVHTAGVVDDGVVESMSVGRVASVFGPKADAAWFLHELT
RDMGLSAFVLFSSMAGTVGGGGQSNYAAANAYLDGLAEYRRGLGLAATSLAWGLWEDTAN
GGMTGHLAEADRTRMARGGVFPLALDEGLALFDAALATGKATLVPVHLDTTALRAHADEL
PALFRDLVRAPKRRTAAEGRAADSADDLAGRLAGLAAEARRPLVLGVVRAQVAQVLGYAS
ADLVEPERAFQDLGFDSLTAVELRNGLTAVAGVRLPATLVFDYPSTDILTDFLLAELSGK
VAVAAPLAPLATTGPVHDDPIVVIGMGCRYPGGVRSPEDLWRLVADGRDAISEFPTDRGW
DLDALYHPDPDHAGTSYTREGGFLHDAADFDADFFGISPREAIVMDPQQRLLLETSWEAF
EQAGIVPADLKGTQTGVFAGVMYHDYGTRIVDIPEGAEGYLGTGISGSVVSGRVAYTLGL
EGPAVTIDTACSSSLVALHSAAHALRQGECSMAIAGGVTVMAGPDTFIDFSRQRGLATNG
RCKAFSADADGTGWGEGVGVLVLERLSDARKNGHEVLAVIRGSALNQDGASNGLTAPNGP
SQQRVIRQALASAGLTTSDVDAVEAHGTGTTLGDPIEAQAVLATYGQDRAADQPLWLGSA
KSNFGHTQAAAGVAGVIKMVMAIRNGVLPKTLHVSEPSTHVDWSAGAVELLAEAREWPET
GRPRRAGVSSFGVSGTNAHVIVEQAPTEEQAPADAPAPTDAPAGTPVPWIVSGRTADSLR
DQARRLLEHLDRNGDLDPQDVARALLTTRTRFHHRAAVVATERQDIVAALEALADGRPVS
GLVQGTATTMAKSAFLFTGQGAQRVGMGRELAAEFPVFAASLEQTCGLLERAGVAVREVL
FAEEGSAEAALLTRTVYAQAALFAVEVALFRLVESFGVVPDFVAGHSVGEIAAAHVAGVF
SLEDAVSLVAARGRLMDALPEGGAMVAVQATEEDVLALLEGVEDASIAAINGPDAVVVSG
TETGVARVVDVLRERGAKTKRLDVSHAFHSPLMEPMLADFARVVAGLSYEDPAIPVVSNV
SGSMADGELSTPGYWVRHVREAVRFGAGVETLLGAGVSSFLEIGPDGVLSGMARTSVPEG
ADVECAPLMRRDRAEVREFLTGLSRLAVRGVPVSWSPLVAGGRRVELPTYAFQRRRFWLD
AGHSVTDASGLGQTAAGHPLIGAVVGLAGGDGVVLTGRVSLHTHPWLADHQVAGVTLLPG
TGFVELAVRAGDEVGCGRLEELTLEAPLVVPDRGAVQLQVVVGGLEESGVRTVSVYSRAE
DTDNPDTPWTRHASGALGTAADPADFDLTAWPPAGTEAVEIGDFYGELAATPDGLVYGPL
FQGLTAAWRKGDEVYAEIELPEGAAVDAARFGMHPALLDAALHAVGLSNDADADADAGTA
QEDGTVARLPFAWSGVTLHRSGATRLRLSVRPTGGDSYHLRIADAVGAPVATVGELLLRG
ISAEQLARAGTDRPDALFRLEWEALRGDGATTAGEWALLGGDPYGLAPARAVPYGDLDAL
AAEAEGGTPPEVVLLPLTVPAGEEPDAGERAAHRALRAVRSWLADDRFAAATLVLMTRGA
LAATPGDEVTDVAGAEVWGLVRSAQTEHPGRFVLVDSDGSEASARALPAAVASGEPQLAL
RAGTVNAARLGRVERAGAEAVATFDPERTVLITGGTGALAGQLARHLARAYGVRHLLLAG
RRGPSAPHAAELVAELAELGALAEVVACDVADREALTALLAAVPADRPLGAVVHTAGVLD
DGLVESLTPERLDAVLHPKATAALLLDELTRDADLTAFVLFSSAAGTLGSPGQANYAAAN
AGLDALAVRRRGQGLPGLSLGWGLWQADGGMGGALSGGDQARIARGGVAALTTDHGLALF
DTACAGPDAVVLPMLLDLRPQDDVPHLLRSLVSARRKGASAGARHEGPAELRRRLAAATP
DERYEHLLGLVRSCTAVVLGHRGPQDVDPGVGFLESGFDSLTAMELRNQLNEATGLRLAA
TVVFDHTTPADLARHLVDGVADTVAAAPGQQPAPRSDDDADTLSGLFRTAVRAGQVTKGV
DLLRAVAELRPAFHSADELGDDLPVPVRLAQGPSAARLFCFASPMAMGGTHQYARLAAHF
RGVREVSALPMPGFATGDLLPATAEAVVEVFGRSLLRAAGDEPFVLLGYSAGGVFAHAVA
AWLESEGCAPAAVVLLDSYRADGGTSMDGDFWVSMVEGLFSREEVFGRFTSARLSAMGRY
ARLVGEVKTGEVKAPVLFVRPERSLSASADAGGVGGGDAGAAAATDDWRASWDTAETVLE
VAGDHFDIIESQAAATADAVEGWLADRV
selected fasta
>polyketide synthase [polyketide synthase modules 7-8]
ATGTCGAACGAAGAGAAGCTCCTCGACTACCTCAAGCGGGTCACCGCCGATCTCCACGCG
ACCCGGCAGCGGCTGCGTGAGGCGGAGTCCGATGAGCAGGAGCCGATCGCGGTCGTCGCG
ATGGGCTGCCGCTACCCGGGGGACGTCCGTACCCCCGAGGACCTGTGGCAGCTCGTCGCG
ACGGGCGGTGACGCCGTCACCGAATTCCCCGCCGACCGGGGCTGGGACTTCGACACACTC
CTCGGCGGCGATGCGGGCGCATCCGGGAGCACCTATGTGGCCCGCGGCGGGTTCGTCCAC
GACGCGGCCGACTTCGATGCGGACTTCTTCGGCATCTCGCCGCGCGAGGCGCTGGCGATG
GACCCGCAGCAGCGGCTGCTGCTGGAACTCGCCTGGGAGACCAGCGAGCGGGCCGGCATC
GACCCGCACAGCCTGCGGGGTGCCTCCGTCGGCGTCTTCGCCGGCACCAACGGTCAGGAC
TACGCCGACCTGATGGACCGGGCGCCGGAGGACACCGAGGCATACCTCTCCACCGGTAGC
GTCGCGGCCGTCGTCTCCGGCCGGGTCTCGTACGCGCTGGGTCTGGAGGGCCCTTCGGTC
TCGGTCGACACCGCCTGCTCCTCCTCGCTCGTCGCGCTGCACCTCGCCTGCCAGGCACTC
CGGCAGAAGGAGTGCTCCATGGCCTTCGCGGGTGGCGTCACGATCATGTCGACGCCCGGG
CCGTTCATCGCCTTCAGCAGGCAGAGCGGTCTCGCGTCGGACGGCCGGTGCAAGGCGTTC
TCCGACGACACGGACGGTACGGGGTGGGGTGAGGGCGCGGGCCTCCTGCTGCTGGAGCGG
CTCTCGGACGCGCGCAGGAACGGGCATCAGGTGCTCGCCGTGGTGCGGGGCTCGGCGTTG
AACCAGGATGGTGCGAGCAATGGTCTGACGGCGCCGAACGGTCCGTCCCAGCAGCGGGTG
ATCCGCCAGGCGCTGGCCAACGCCGGTCTGACGGCGGCCGAGGTGGACGCGGTCGAGGCG
CACGGCACCGGTACGACCCTCGGTGACCCGATCGAGGCGCAGGCCATCCTCGCCACGTAT
GGGCAGAGCCGCGAGCAGGACCAGCCGCTCTGGCTCGGCTCCATCAAGTCGAACATCGGT
CATACCCAGGCCGCGGCCGGGGTCAGCGGTGTGATCAAGATGGTGATGGCCATCCAGAAC
GGCGTGCTGCCGAAGACGCTGCATGTGTCGGAGCCGTCGTCCGTTGTGGATTGGTCCGCT
GGTGCGGTGGAGCTACTCACGGAGGCTCGGGAGTGGCCGGAGACCGGTCGTCCGCGCCGT
GCCGGTGTGTCGTCGTTCGGTGTGAGCGGTACGAACGCCCACATCATCATGGAGCAGGCG
CCCGTGCCTGAGGCAGAGTCGGAGCCGGACGGCGAAGCACCCGCCGCGGTGTCCGGGCTG
CCGGTTCCTTGGGTGGTCTCCGGGAAGACCGCCGACGCGTTGCGGGCGCAGGCCGAGCGG
CTGCTGTCGTTCGTCTCCGCCGACGCGGATGTCTCCGTGGTGGATGTGGCGTACTCGCTG
GGTGTGTCGCGTGCGGGTCTTGAGCATCGTGGTGTGGTGGTGGGGGAGTCGCGTGCGGAG
TTGCTCGCGGCTCTGGAGTCGTTGGCGTCCGGGGTTGAGTCGCCGGGTGTGGTGACGGGT
CGGGTCGCCGAGGGTCGGTTGGCGTTCTTGTTCACGGGGCAGGGTGCGCAGCGGGTTGGT
ATGGGGCGTGAGCTGGCTGCTGCGTTCCCGGTGTTTGCGGCGTCTCTTGAGGAGACGTGT
GGCTTGTTGGAGCGTGCCGGGGTTGCGGTGCGTGAGGTGCTGTTCGCCGAGGAGGGTTCG
GCCGAGGCCGCCCTGCTGACGCGGACGGTGTATGCGCAGGCGGCGTTGTTTGCGGTGGAG
GTGGCGCTGTTCCGGTTGGTGGAGTCGTTCGGTGTGGTGCCGGACTTTGTCGCTGGGCAT
TCGGTGGGTGAGATCGCTGCCGCGCATGTCGCGGGGGTGTTCTCGCTTGAGGATGCGGTG
TCTCTGGTGGCGGCTCGTGGTCGGTTGATGGATGCGCTGCCGGAGGGTGGGGCGATGGTG
GCGGTGCAGGCCACCGAGGAGGATGTGCTCGCTCTGTTGGAGGGGGTGGAGGATGCCTCC
ATCGCGGCGATCAATGGCCCCGACGCCGTGGTGGTCTCCGGCACCGAGGCCGGTGTCGCC
CGCGTAGTGGACGTACTCCGGGAGCGGGGTGCGAAGACCAAGCGGCTCGACGTCAGCCAC
GCCTTCCACTCGCCGCTGATGGAGCCGATGTTGGCTGAGTTCGCCACCGTCGTGGAGGGG
TTGTCGTTCGCGGCTCCCACCATTCCGGTGGTGTCGAATGTGTCGGGTGCGGTGGCGGAT
GCCGAGTTGTCGTCGCCGGGTTACTGGGTGCGGCATGTGCGTGAGGCGGTTCGTTTCGGT
GCCGGGGTGGAGACCCTGCTCGGCGCTGGTGTGTCGTCGTTCCTGGAGATCGGTCCGGAC
GGTGTGCTGAGCGGGATGGCCCGTGGGTCGATCTCCGACGGCGCCGACGTTGGCTGTGTC
CCCGTGATGCGCCGGGGCCGGGGTGAGGTGCGGGAGTTCCTCACCGGCCTCTCCCGGATC
GCCGTACGGGGAGTCCCCGTGAGCTGGGGTCCGCTGCTGGCGGGTGGTCGGCGGGTCGAG
CTGCCGACGTACGCCTTCCAGCGTCGCCGGTTCTGGCTGGAGGCGGGGCACTCCGTCACG
GACGCTTCGGGTCTGGGCCAGACGGCTGCCGGGCATCCGCTGATCGGTGCTGTGGTGAGT
CTGGCCGGTGGTGACGGTGCCGTGCTGACCGGTCGGGTGTCGTTGAACACGCATCCCTGG
CTGGGCGACCACCGGGTCGCGTCTTCGGTGGTGTTCCCGGGGACCGGGTTCGTCGAGCTG
CTGATGCGCGCGGGCGACGAGGTCGGCTGCGGCCGGCTGGAGGAGCTGAACCAGGAGGCA
CCGCTCGTCGTACCCGACCGGGGCGCCGTCCAGATCCAGGTGACCGTGGAGGCCCCCAAT
GCTGTGGGAGAGCGACCGGTCGCGGTTTACTCGCGGCTGGAGGACACGGATACGGACGCC
CCGTGGACCCGGCACGCCAGTGGTCTGCTGAGCCCAACCACCGCTTCGGCGGACTTCGAC
TTCACGGCATGGCCGCCGGCCGGTGCGGACCCCCTCTCCGTCGACGGAATGTATGACCGC
CCGGACTCGGGCCTGGTCTACGGTCCCCTGTTCCAGGGGCTGACGGCCGCCTGGCGCAAG
GGCGATGAGGTGTACGCGGAGATCGAGCTGCCCGAGGGGGCGGCGGTCGACGCCGCCCGC
TTCGGGATGCACCCCGCCCTCCTCGACGCCGCCCTCCACGCCCTCGGGTTCTCGGCCTCC
TACGAGGACCAGGAGGAGGACGGCACCGTGGCCCGGCTGCCCTTCTCGTGGTCGGGGGTG
TCGTTGTTTGCTTCGGGTGCTTCGGTGTTGCGGGTGTGTGTGCGTCATGTGGCGCGGGAT
CGGGTGTCGTTGTTGGTGGCTGATGGTGTGGGTGTGCCGGTTGCGGTGGTGGAGTCGTTG
GTGTTGCGGGCGATTTCTGCTGGTGCGGTGGCGGTTGCTGGGGTGGGTTCGGGTGTGGGT
GGTGGGTTGTTTGAGGTGGTGTGGTCTCCGGTTGTTGGTGTGAGGGGTGTGGATGTGTCG
GGTGTGGTGGTGTTGGAGGCTGGTGTGGGTGTTGGTGGGGATGGGGTTTCGGTGGTGGGT
GGTGTGTTGGAGGGTTTGCAGGGTGTGTTGGGTGGGGGTTCTGGTTCTCGTGTGGTGGTG
GTGACGCGGGGTGCGGTTGGTTCTGGTGGTGTGGTGGATGTGTCGGGTGCGGGTGTGTGG
GGGTTGGTGCGGTCGGTTCAGGCCGAGCATCCGGGTCGGTTGGTGTTGGTGGATGTGGGT
GTTGAGGGTGATGTGGGTGTGGGTGTGGGGTTGGCTTTGGGTTCGGGTGAGGAGCAGGTG
GTGGTGCGTGGGGGTGAGGTGTTTGTTCCTCGTTTGGCGCGGGTGAGTGTTGTGGCGGCG
GATGTGGTGCCGGATGCGGGTGTTGATGGTGCCGATATCAGGGGTGGTTTGGGTGATGGT
GTGGTGTTGGTGACGGGTGGTACGGGTGGGTTGGGTGCGTTGGTGGCGCGGCATGTGGTG
GTGGAGCGTGGGGTGCGTCGTTTGGTGTTGGTGTCGCGTCGTGGGTTGGGTGCTCCGGGT
GCGGTGGGGTTGGTGGCTGAGCTTGAGAGCTTGGGTGCTGTGGTGGAGGTGGTGGCGTGT
GATGTGAGTGATCGTGTGGCGTTGGCGGGTGTGGTGGGGGGTATTGGGTCGGATCTTTCG
GCTGTGGTGCATACGGCGGGTGTGGTGGATGACGGTGTGGTGGAGTCGATGTCGGTGGGT
CGGGTGGCGTCGGTGTTTGGTCCGAAGGCGGATGCTGCGTGGTTTTTGCATGAGTTGACG
CGTGACATGGGGCTGTCGGCGTTTGTGTTGTTCTCGTCGATGGCGGGGACGGTGGGTGGT
GGTGGTCAGAGCAACTATGCGGCGGCGAATGCTTATTTGGATGGTTTGGCGGAGTATCGG
CGTGGGTTGGGGCTGGCGGCGACATCCCTGGCCTGGGGACTCTGGGAAGACACCGCGAAC
GGCGGTATGACGGGCCACCTGGCCGAAGCCGACCGTACGCGGATGGCACGCGGGGGAGTC
TTCCCTCTGGCGCTGGACGAGGGGCTCGCACTCTTCGACGCCGCCCTCGCCACCGGAAAG
GCGACACTCGTCCCCGTCCATCTGGACACCACCGCGCTGCGCGCACACGCTGACGAACTG
CCCGCCCTCTTCCGTGACCTCGTCCGCGCGCCGAAGCGGCGCACGGCGGCGGAAGGCCGT
GCGGCGGACTCCGCCGACGACCTCGCGGGCCGCCTCGCCGGCCTGGCCGCCGAGGCGCGC
CGGCCGTTGGTGCTCGGTGTGGTTCGTGCGCAGGTCGCGCAGGTGCTGGGGTACGCCTCG
GCGGATCTCGTGGAGCCGGAGCGCGCGTTCCAGGACCTCGGCTTCGATTCGCTGACGGCC
GTCGAACTGCGCAACGGCCTCACGGCCGTCGCGGGGGTCCGCCTCCCGGCGACGCTCGTC
TTCGACTATCCCTCGACCGACATCCTCACCGACTTCCTCCTCGCCGAACTCTCCGGCAAG
GTCGCCGTGGCCGCGCCCCTCGCGCCGCTCGCCACCACCGGGCCGGTGCACGACGACCCG
ATCGTCGTCATCGGCATGGGCTGCCGCTACCCAGGCGGGGTCCGCTCGCCGGAGGACCTG
TGGCGGCTGGTCGCCGATGGCCGGGATGCGATATCGGAGTTCCCGACCGACCGCGGCTGG
GACCTCGACGCGCTGTACCACCCGGACCCGGACCACGCCGGGACCAGCTACACCCGCGAG
GGCGGGTTCCTGCACGACGCGGCCGATTTCGACGCGGACTTCTTCGGGATCTCGCCGCGT
GAGGCCATCGTCATGGACCCGCAGCAGCGGCTGCTCCTTGAGACGTCCTGGGAGGCGTTC
GAGCAGGCCGGCATCGTGCCCGCCGACCTCAAGGGCACCCAGACCGGCGTCTTCGCCGGA
GTGATGTACCACGACTACGGCACCCGAATCGTCGACATTCCCGAGGGGGCCGAAGGCTAT
CTGGGCACCGGCATCTCCGGCAGCGTCGTCTCCGGCCGGGTCGCGTACACCCTGGGTCTG
GAGGGCCCGGCGGTCACGATCGACACCGCCTGCTCCTCCTCGCTCGTCGCCCTGCATTCC
GCCGCGCACGCCCTGCGCCAGGGTGAGTGCTCCATGGCCATCGCCGGTGGTGTCACCGTC
ATGGCGGGCCCCGACACCTTCATCGACTTCAGCAGGCAGCGCGGTCTGGCCACGAACGGT
CGCTGCAAGGCGTTCTCGGCGGACGCCGACGGCACCGGCTGGGGCGAGGGCGTCGGCGTC
CTGGTCCTGGAGCGGTTGTCGGACGCGCGGAAGAACGGGCACGAGGTACTCGCGGTCATC
CGTGGTTCGGCGCTGAACCAGGACGGTGCGAGTAACGGTCTGACGGCGCCGAACGGTCCT
TCGCAGCAGCGGGTGATCCGCCAGGCACTGGCCAGCGCCGGTCTGACGACGTCGGACGTC
GACGCGGTCGAGGCGCACGGCACCGGCACCACGCTCGGTGACCCGATCGAGGCCCAGGCG
GTGCTGGCCACCTACGGCCAGGATCGCGCCGCGGACCAGCCGCTCTGGCTCGGCTCGGCC
AAGTCGAACTTCGGTCACACGCAGGCCGCGGCCGGTGTCGCCGGTGTGATCAAGATGGTG
ATGGCCATCCGGAACGGCGTGCTGCCGAAGACGCTGCATGTGTCGGAGCCTTCGACACAT
GTGGACTGGTCCGCCGGCGCCGTGGAGCTGCTGGCGGAGGCCCGGGAGTGGCCGGAGACC
GGTCGTCCGCGCCGCGCCGGTGTGTCGTCGTTCGGTGTGAGCGGTACGAACGCGCACGTC
ATCGTCGAGCAGGCCCCCACCGAGGAGCAGGCCCCCGCGGACGCGCCTGCCCCGACGGAC
GCGCCCGCCGGCACTCCGGTGCCCTGGATCGTCTCCGGTCGGACCGCCGACTCACTGCGC
GACCAGGCCCGCCGTCTGCTGGAGCACCTCGACCGGAACGGCGACCTCGACCCGCAGGAC
GTCGCGCGGGCCCTCCTCACCACCCGTACCCGCTTCCACCACCGTGCCGCCGTTGTGGCG
ACCGAGCGACAGGACATCGTCGCGGCGCTCGAAGCACTCGCCGACGGCCGGCCCGTGAGC
GGTCTGGTTCAGGGGACGGCCACCACCATGGCGAAGTCCGCGTTCCTGTTCACGGGGCAG
GGTGCGCAGCGGGTCGGCATGGGTCGGGAACTCGCGGCCGAATTCCCGGTGTTTGCGGCG
TCTCTTGAGCAGACGTGTGGTCTGTTGGAGCGTGCCGGGGTTGCGGTGCGTGAGGTGTTG
TTCGCCGAGGAGGGTTCGGCCGAGGCCGCCCTGCTGACGCGGACGGTGTATGCGCAGGCT
GCGTTGTTCGCCGTCGAGGTGGCGCTGTTCCGGTTGGTGGAGTCGTTCGGTGTGGTGCCG
GACTTTGTCGCTGGGCATTCGGTGGGTGAGATCGCTGCCGCGCATGTCGCGGGGGTGTTC
TCGCTTGAGGATGCGGTGTCCCTGGTGGCGGCTCGTGGTCGGTTGATGGATGCGCTGCCG
GAGGGTGGGGCGATGGTGGCGGTGCAGGCCACCGAGGAGGATGTGCTTGCCCTCCTGGAG
GGGGTGGAGGACGCCTCCATCGCCGCGATCAACGGCCCCGACGCCGTGGTCGTCTCCGGC
ACCGAGACCGGTGTCGCCCGCGTAGTGGACGTACTCCGGGAGCGGGGCGCGAAGACCAAG
CGGCTCGACGTCAGCCACGCCTTCCACTCACCGCTGATGGAGCCGATGCTCGCCGACTTC
GCACGGGTGGTCGCGGGTCTGTCCTATGAGGACCCTGCGATCCCGGTCGTGTCGAATGTG
TCGGGGTCGATGGCGGACGGTGAGCTGTCGACGCCGGGATACTGGGTGCGGCATGTTCGT
GAGGCGGTTCGTTTCGGTGCCGGGGTGGAGACCCTGCTCGGCGCTGGTGTGTCGTCGTTC
CTGGAGATCGGCCCCGATGGTGTGCTGAGCGGGATGGCCCGTACGTCCGTACCTGAGGGT
GCGGATGTGGAGTGCGCGCCGCTGATGCGCCGAGACCGCGCCGAGGTACGGGAGTTCCTC
ACCGGCCTCTCCCGTCTCGCCGTACGCGGTGTCCCGGTGAGCTGGTCCCCCCTCGTGGCG
GGGGGCCGGCGGGTCGAGCTGCCGACGTACGCCTTCCAGCGTCGCCGGTTCTGGCTCGAC
GCCGGACACTCGGTCACGGACGCTTCGGGTCTGGGCCAGACGGCCGCCGGGCATCCGCTG
ATCGGTGCCGTGGTGGGTCTGGCCGGTGGCGATGGTGTCGTCCTGACCGGTCGGGTGTCG
TTGCACACCCACCCCTGGTTGGCGGATCACCAGGTCGCGGGGGTGACGCTGCTTCCGGGT
ACGGGCTTTGTGGAGCTGGCGGTCCGTGCCGGTGACGAGGTCGGCTGTGGCCGGCTGGAG
GAACTGACCCTGGAGGCCCCGCTGGTCGTGCCCGACCGGGGCGCCGTCCAGCTCCAGGTC
GTCGTCGGCGGGCTGGAGGAATCCGGCGTCCGTACCGTCAGCGTCTACTCCCGAGCCGAG
GACACCGACAACCCCGACACCCCCTGGACCCGGCACGCCAGTGGTGCCCTCGGCACGGCG
GCCGACCCGGCCGACTTCGACCTCACCGCCTGGCCGCCGGCCGGAACCGAGGCCGTCGAG
ATCGGGGACTTCTACGGCGAACTGGCCGCCACACCCGACGGTCTGGTCTACGGTCCGCTG
TTCCAGGGGCTGACGGCCGCCTGGCGCAAGGGCGATGAGGTGTACGCGGAGATCGAGCTG
CCCGAGGGCGCGGCGGTCGACGCCGCCCGCTTCGGGATGCACCCCGCCCTCCTCGACGCC
GCCCTCCACGCCGTCGGACTCTCGAACGACGCCGACGCCGACGCCGACGCGGGCACGGCA
CAGGAGGACGGCACCGTGGCCCGGCTCCCCTTCGCCTGGTCCGGTGTGACGCTCCACCGC
TCCGGCGCGACCCGGCTGCGGCTCTCCGTACGGCCCACCGGAGGCGACAGCTACCACCTG
CGGATCGCCGACGCGGTCGGCGCGCCCGTCGCGACCGTCGGGGAACTGCTGCTGCGCGGT
ATCAGCGCCGAGCAGCTCGCGCGGGCCGGCACCGACCGCCCGGACGCGCTCTTCCGGCTG
GAGTGGGAGGCGCTGCGCGGCGACGGGGCGACCACCGCGGGGGAGTGGGCGCTGCTCGGA
GGGGACCCGTACGGTCTCGCTCCGGCCCGTGCCGTCCCGTACGGCGATCTCGACGCCCTG
GCGGCCGAGGCCGAGGGCGGCACGCCGCCCGAGGTCGTCCTGCTGCCCCTGACAGTGCCC
GCCGGCGAAGAGCCGGACGCGGGCGAGCGGGCCGCGCACCGGGCGCTGCGCGCGGTGCGG
TCCTGGCTCGCCGACGACCGGTTCGCGGCTGCGACCCTCGTCCTGATGACCAGGGGCGCG
CTGGCGGCGACCCCCGGCGATGAGGTCACCGATGTGGCGGGCGCCGAGGTCTGGGGCCTC
GTACGGTCGGCGCAGACCGAGCACCCCGGCCGGTTCGTCCTGGTCGACTCGGACGGTTCC
GAGGCGTCCGCGCGGGCGCTCCCGGCCGCCGTGGCGAGCGGTGAGCCACAGCTCGCACTG
CGCGCGGGTACCGTCAACGCGGCCCGGCTGGGCCGCGTGGAGCGGGCCGGGGCGGAGGCC
GTGGCCACGTTCGATCCCGAGCGGACCGTCCTGATCACCGGGGGTACGGGCGCGCTCGCC
GGCCAACTCGCCCGGCATCTCGCCCGTGCGTACGGCGTCCGGCATCTGCTGCTCGCCGGG
CGGCGCGGCCCGAGCGCCCCCCACGCGGCGGAGCTGGTCGCCGAGCTGGCCGAACTGGGC
GCCCTGGCCGAGGTCGTGGCCTGCGATGTGGCCGACCGTGAGGCGCTGACCGCCCTGCTG
GCCGCGGTCCCCGCCGACCGGCCGCTGGGTGCCGTCGTGCACACGGCGGGGGTCCTGGAC
GACGGGCTCGTGGAGTCCCTCACGCCCGAGCGGCTCGACGCGGTGCTCCACCCGAAGGCG
ACCGCGGCCCTCCTGCTCGACGAACTGACCCGTGACGCCGACCTGACGGCGTTCGTGCTC
TTCTCCTCCGCCGCGGGCACCCTCGGCAGCCCCGGTCAGGCCAACTACGCGGCGGCCAAC
GCCGGTCTCGACGCGCTCGCCGTCCGGCGACGCGGCCAGGGGCTGCCCGGTCTGTCGCTC
GGCTGGGGCCTGTGGCAGGCGGACGGCGGTATGGGCGGCGCGCTCAGCGGCGGCGACCAG
GCGCGTATCGCCCGTGGTGGTGTCGCCGCGCTCACGACCGACCACGGTCTGGCGCTCTTC
GACACCGCCTGCGCCGGTCCGGACGCCGTCGTACTGCCGATGCTGCTGGACCTGCGACCG
CAGGACGACGTACCGCATCTGCTGCGGTCCCTGGTGAGCGCGCGCCGCAAGGGCGCGTCG
GCGGGAGCCCGCCACGAGGGTCCGGCCGAGCTGCGGCGCAGGCTCGCCGCCGCGACGCCC
GACGAGCGGTACGAACACCTCCTCGGCCTGGTCCGCTCGTGCACCGCCGTGGTGCTGGGG
CACCGGGGCCCGCAGGACGTCGATCCCGGGGTCGGGTTCCTGGAGTCCGGTTTCGACTCG
CTGACCGCGATGGAGCTGCGCAACCAGCTCAACGAGGCCACCGGTCTGCGGCTCGCGGCC
ACCGTCGTCTTCGACCACACCACCCCCGCAGATCTGGCGCGGCACCTGGTCGACGGAGTG
GCCGACACGGTCGCCGCCGCACCGGGCCAGCAGCCGGCGCCGCGGTCGGACGACGACGCG
GACACCCTGAGCGGGCTGTTCCGTACGGCGGTACGGGCCGGTCAGGTGACGAAGGGCGTC
GATCTGCTACGGGCCGTGGCCGAGCTGCGCCCGGCCTTCCACAGCGCCGACGAACTGGGC
GACGATCTGCCGGTGCCGGTACGGCTCGCCCAGGGCCCGAGTGCCGCGCGGCTGTTCTGC
TTCGCCTCGCCGATGGCGATGGGCGGCACGCACCAGTACGCCAGGCTGGCGGCGCACTTC
CGGGGCGTACGCGAGGTCTCGGCGCTCCCCATGCCCGGATTCGCGACGGGAGACCTGCTG
CCGGCGACGGCCGAAGCCGTCGTGGAGGTCTTCGGCCGGAGCCTCCTGCGGGCGGCCGGG
GACGAGCCGTTCGTCCTCCTCGGCTACTCGGCTGGCGGTGTCTTCGCCCACGCGGTGGCC
GCCTGGCTGGAGTCCGAAGGGTGCGCGCCAGCCGCCGTGGTGCTGCTGGACAGCTACCGC
GCGGACGGTGGCACCAGCATGGACGGCGACTTCTGGGTGAGCATGGTGGAGGGCCTGTTC
TCGCGGGAAGAGGTCTTCGGACGGTTCACCAGCGCCCGACTGTCGGCGATGGGCCGGTAC
GCGCGGCTCGTCGGCGAGGTCAAGACGGGTGAGGTGAAGGCGCCGGTGCTCTTCGTCCGC
CCGGAGCGGTCGCTGAGCGCGAGCGCCGACGCGGGCGGAGTCGGGGGCGGGGACGCCGGG
GCCGCTGCCGCCACGGATGACTGGCGGGCCTCGTGGGACACGGCCGAGACGGTGCTGGAG
GTGGCGGGCGACCACTTCGACATCATCGAGAGCCAGGCCGCCGCGACCGCCGACGCCGTG
GAGGGATGGCTCGCGGACCGGGTCTGA
[7] KS34..409
[7] AT569..886
[7] malonyl-CoA760..764
[7] DH932..1094
[7] KR1380..1558
[7] ACP1664..1734
[8] KS1759..2134
[8] AT2295..2612
[8] malonyl-CoA2486..2490
[8] DH2658..2824
[8] KR3148..3328
[8] ACP3423..3497
[8] TE3577..3804
[7] KS100..1227
[7] AT1705..2658
[7] malonyl-CoA2278..2292
[7] DH2794..3282
[7] KR4138..4674
[7] ACP4990..5202
[8] KS5275..6402
[8] AT6883..7836
[8] malonyl-CoA7456..7470
[8] DH7972..8472
[8] KR9442..9984
[8] ACP10267..10491
[8] TE10729..11412

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [3577-3804]  3e-27 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [563-693]  G3DSA:3.40.366.10 [760-875]  G3DSA:3.40.366.10 [2286-2419]  G3DSA:3.40.366.10 [2486-2601]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [3149-3315]  1.9e-59 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1692-1707]  PS00012 [3455-3470]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1657-1775]  1.10000150671642e-25 SSF47336 [3419-3514]  1.10000150671642e-22 SSF47336
SSF47336   ACP_like
 [1668-1726]  1.7e-07 PF00550 [3431-3496]  2.4e-12 PF00550
PF00550   PP-binding
 [1665-1739]  4.2e-39 G3DSA:1.10.1200.10 [3426-3499]  4.2e-39 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1664-1734]  PS50075 [3423-3497]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1380-1557]  1.40000000000001e-55 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1.39999999999997e-90 PF00109 [1759-2009]  4.30000000000003e-100 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  4.9e-48 PF02801 [2017-2134]  1.09999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-886]  1.5e-62 PF00698 [2295-2612]  2.50000000000001e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.2e-15 PF08990
PF08990   Docking
 [2-34]  1.9000006847787e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-870]  1.59998835313644e-71 SSF52151 [2292-2579]  2.99998750445706e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-759]  1.20000117458134e-17 SSF55048 [2421-2485]  1.50000306971104e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [296-461]  1.79999999999997e-127 G3DSA:3.40.47.10 [1761-2021]  G3DSA:3.40.47.10 [2022-2189]  1.79999999999997e-127 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  3.49999466863949e-97 SSF53901 [1751-2133]  3.99998544139406e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1378-1564]  2.30000000000004e-67 G3DSA:3.40.50.720 [3148-3331]  5.99999999999995e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1922-1938]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-867]  4.50001022902825e-117 SM00827 [2296-2593]  1.50000965748778e-113 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [3579-3804]  5.20000089003336e-114 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1665-1737]  7.10001443313147e-32 SM00823 [3428-3500]  7.49999605851445e-30 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [932-1094]  8.89993011983204e-81 SM00826 [2658-2824]  3.10001307370203e-81 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1761-2187]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1380-1558]  7.40000780398342e-57 SM00822 [3148-3328]  1.10000150671643e-56 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit