close all open/close all

CDS information : Vicen_00080


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction33,972 / 33,262 / - [in whole cluster]
33,972 / 33,262 / - [in contig]
Locationcomplement(33262..33972) [in whole cluster]
complement(33262..33972) [in contig]
TypeCDS
Length711 bp (236 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N-methyltransferase
Product (GenBank)N-methyltransferase
Gene
Gene (GenBank)vinG
EC number2.1.1.-
Keyword
  • vicenisamine
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N-methyltransferase [N-methyltransferase]
MYEEDFARVYDDIYRRHKDYAGEAARIRELALERNPGAADLLDVGCGTGEHLALLRDDFA
VTGVDLSAPMVRVAEAKLPGVPVHEGDMRTFGLDRSFDVICSMYSSVGYLETLDGLFAAL
KNMAHHLRPGGVLIIEPWILRDSWNGGDLVEASFENEGGKVVRMGRWTTRAGRSHVEMHY
LVTSGDDPVRHFVDEQELSLFSKDEYEEAFRAAGCSVEYLPDGYVDRGVFVGVRQP
selected fasta
>putative NDP-hexose N-methyltransferase [N-methyltransferase]
ATGTACGAAGAGGACTTCGCGCGCGTCTATGACGACATCTATCGGCGGCACAAGGACTAC
GCCGGTGAGGCCGCCCGCATCCGCGAGCTGGCGCTCGAACGCAACCCCGGAGCGGCCGAT
CTGCTCGATGTGGGCTGTGGCACCGGCGAGCACCTCGCGCTGCTGAGGGACGATTTCGCC
GTCACCGGTGTGGACCTGTCGGCGCCGATGGTCCGGGTCGCCGAGGCCAAGCTGCCGGGG
GTGCCGGTCCACGAGGGCGATATGCGCACCTTCGGGCTCGACCGGAGCTTCGACGTGATC
TGTTCGATGTACAGCTCCGTCGGCTATCTGGAGACCCTGGACGGTCTGTTCGCCGCCCTG
AAGAACATGGCCCACCATCTGCGTCCCGGCGGGGTGCTGATCATCGAGCCGTGGATTCTG
CGGGACAGTTGGAACGGCGGCGATCTGGTGGAGGCGAGCTTCGAGAACGAGGGCGGCAAG
GTGGTCCGCATGGGCCGCTGGACCACCCGGGCCGGGCGCAGCCATGTGGAGATGCACTAC
CTGGTGACGAGCGGCGACGATCCCGTACGGCACTTCGTGGACGAACAGGAGCTGTCGCTG
TTCTCCAAGGACGAGTACGAGGAGGCGTTCCGCGCGGCCGGGTGCTCGGTGGAGTACCTG
CCCGACGGGTATGTCGACCGCGGTGTCTTCGTGGGGGTGCGACAGCCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit