close all open/close all

CDS information : Vicen_00090


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction35,137 / 33,980 / - [in whole cluster]
35,137 / 33,980 / - [in contig]
Locationcomplement(33980..35137) [in whole cluster]
complement(33980..35137) [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 aminotransferase
Product (GenBank)aminotransferase
Gene
Gene (GenBank)vinF
EC number2.6.1.-
Keyword
  • vicenisamine
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q9ZGH0
NITE
Pikro_00160
PmId
[17630700] Molecular architecture of DesI: a key enzyme in the biosynthesis of desosamine. (Biochemistry. , 2007)
ACC
Q331S0
PmId
[17532307] Enzymatic synthesis of dTDP-4-amino-4,6-dideoxy-D-glucose using GerB (dTDP-4-keto-6-deoxy-D-glucose aminotransferase). (Carbohydr Res. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 aminotransferase [aminotransferase]
MTDSPVFREPLHVGRPNIGSRARLTERLEGALDRLYLTNGPLVREFEERLAEVAGVDHCV
AVCNATIGLQVAAKAAGIRGGDEVIVPAFTWVATAAALDWIGIVPVFCDADETTGNIDWT
KVEALIGPRTRGIMGVHVFGRPCEVDELEEIAGRHGLPLLFDSAHAIGCTYKGRPVGGFG
TAEVYSFHATKFVNSFEGGAIVTRDAEFAERCRELRNFGITSAGEIRSGGTNAKMNEAAA
AMGLTSLEVMDSLMEANRINHGRYEKGLDGLPGVWVRGQAEGERANHQYLVIEIDAAVAG
IHRDEVHTALIAQNVLSRRYFHPSCHQVEPYLSDPARHAPHPLPHAEALAERVLALPTGT
TVGPSEIDQVCDIIRRCVSARTPAR
selected fasta
>putative NDP-hexose C-4 aminotransferase [aminotransferase]
GTGACTGATTCCCCTGTGTTCCGCGAGCCGTTGCATGTCGGGCGACCCAATATAGGCAGT
CGTGCCCGCCTGACGGAGAGACTGGAGGGAGCACTCGACCGGCTCTATCTCACCAATGGT
CCGCTGGTCCGAGAATTCGAGGAGAGACTCGCCGAGGTCGCCGGTGTCGACCACTGCGTC
GCGGTGTGCAACGCCACGATCGGGCTCCAGGTGGCGGCGAAGGCCGCGGGAATCCGGGGT
GGCGACGAGGTCATCGTCCCGGCCTTCACCTGGGTGGCCACCGCGGCGGCACTGGACTGG
ATCGGAATCGTCCCCGTCTTCTGCGACGCCGACGAGACGACCGGAAACATCGACTGGACC
AAGGTCGAGGCGCTGATCGGCCCGCGCACCCGCGGCATCATGGGCGTGCACGTCTTCGGC
CGCCCCTGCGAGGTGGACGAGCTGGAGGAGATCGCCGGCCGGCACGGACTGCCGCTGCTG
TTCGACTCCGCGCACGCCATCGGCTGCACCTACAAGGGCCGCCCCGTCGGCGGCTTCGGC
ACGGCGGAGGTGTACAGCTTCCACGCGACCAAGTTCGTCAACAGCTTCGAGGGCGGCGCG
ATCGTCACCCGGGACGCCGAGTTCGCCGAGCGCTGCCGCGAGCTGCGCAACTTCGGCATC
ACCAGCGCCGGTGAGATCCGCTCCGGCGGGACCAACGCCAAGATGAACGAAGCAGCGGCG
GCCATGGGTCTCACCTCGCTGGAGGTGATGGACAGCCTCATGGAGGCCAACCGGATCAAC
CACGGCCGCTACGAGAAGGGCCTGGACGGGCTGCCCGGTGTCTGGGTACGCGGTCAGGCC
GAGGGCGAGCGCGCCAACCACCAGTATCTGGTGATCGAGATCGACGCCGCAGTGGCGGGT
ATCCACCGCGACGAGGTGCACACCGCCCTCATCGCCCAGAACGTCCTCTCGCGCCGCTAC
TTCCACCCCAGTTGCCATCAGGTGGAGCCCTATCTGAGCGACCCCGCCCGGCACGCGCCA
CACCCTCTGCCGCACGCGGAGGCACTGGCCGAGCGCGTGCTCGCCCTCCCGACGGGTACC
ACCGTCGGGCCGTCGGAGATCGATCAGGTCTGCGACATCATCCGGCGCTGTGTCAGTGCC
CGAACCCCGGCCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [28-375]  6.29999999999998e-100 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-382]  1.79999754022378e-106 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [11-248]  1e-71 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [251-379]  1.8e-23 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [21-381]  2.1000026783403e-93 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit