close all open/close all

CDS information : Vicen_00100


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction35,332 / 36,801 / + [in whole cluster]
35,332 / 36,801 / + [in contig]
Location35332..36801 [in whole cluster]
35332..36801 [in contig]
TypeCDS
Length1,470 bp (489 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)dTDP-4-keto-6-deoxyglucose 2,3-dehydratase
Gene
Gene (GenBank)vinD
EC number
Keyword
  • vicenisamine
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [dTDP-4-keto-6-deoxyglucose 2,3-dehydratase]
MTETLSTLPPTHTGDESLAVRIAKSVSVVDDGALHSLDEFHDWFTARGQRTAHVERVPLD
ELTGWSSDPVTGNIGHDSGKFFSVQGLSVELPGAPVPAWAQPIINQPEIGILGILIKEFN
GVLHCLMQAKLEPGNRNGLQLSPTVQATRSNYTRVHQGNPVPYVGYFQDTSANRVITDAL
QSEQGSWFYQKRNRNMVVETEAEIEQHEAFMWLTIGQLHRLLAIDDLINMDTRTVLSCLP
FSGAQLAEQLPGTGGDLRMPILRSCSEDQGSLHTTGDLLSWITDARTRNEVRTRLTPLRD
VAGWRRTPDAITHDTGRFFDVMAVRIETDGDREVRQWTQPMIAPAGIGIVAFLVKRIDGV
LHVLAHARVEPGYLDVVELSPTVMCTPGNYEGLPAAARPPFLGEVLSARPEQVRFETILS
EEGGRFYHAQNRYIIVESDIDVAPELASEYRWMALHQMVGLLRHSHYVNVQARSLIACLH
SLSGAQGRN
selected fasta
>putative NDP-hexose 2,3-dehydratase [dTDP-4-keto-6-deoxyglucose 2,3-dehydratase]
ATGACCGAGACGCTGTCGACTCTTCCGCCCACCCACACCGGCGACGAGTCGCTCGCGGTC
CGTATCGCCAAGTCGGTGAGTGTCGTCGACGACGGGGCGCTGCACAGCCTCGACGAATTC
CACGACTGGTTCACCGCCAGAGGGCAGCGGACCGCACATGTCGAGAGAGTGCCGCTCGAC
GAACTCACTGGTTGGAGCTCCGATCCCGTGACCGGGAACATCGGGCACGACAGTGGGAAG
TTCTTCAGTGTGCAGGGGCTCTCCGTCGAACTGCCCGGTGCGCCGGTGCCCGCCTGGGCG
CAGCCCATCATCAATCAGCCCGAGATCGGGATCCTGGGGATTCTGATCAAGGAATTCAAC
GGTGTTCTGCACTGTCTGATGCAGGCGAAGCTGGAGCCGGGGAACCGCAACGGCCTCCAG
CTCTCCCCGACGGTGCAGGCGACCCGGAGCAACTACACCCGGGTGCACCAGGGCAACCCC
GTCCCGTACGTGGGCTACTTCCAGGACACCTCGGCGAACCGGGTGATCACCGACGCGCTC
CAGTCCGAACAGGGCTCGTGGTTCTACCAGAAGCGCAACCGGAACATGGTCGTCGAGACC
GAGGCGGAGATCGAGCAGCACGAGGCGTTCATGTGGCTGACCATCGGTCAGCTGCACCGC
CTCCTTGCGATCGACGACCTGATCAACATGGACACCCGTACGGTGCTGTCGTGTCTGCCC
TTCTCCGGTGCGCAGCTCGCCGAGCAGCTCCCGGGCACCGGCGGCGATCTGCGGATGCCG
ATCCTGCGCTCGTGCAGCGAGGACCAGGGCAGTCTGCACACCACCGGGGACCTGCTGAGC
TGGATCACTGACGCCCGTACCCGCAACGAGGTGCGCACCCGGCTGACGCCGCTGCGCGAC
GTGGCGGGCTGGCGGCGCACCCCGGACGCGATCACGCACGACACGGGTCGGTTCTTCGAC
GTGATGGCCGTGCGCATCGAGACCGACGGGGACCGCGAGGTCCGCCAGTGGACCCAGCCG
ATGATCGCGCCGGCCGGGATCGGCATCGTGGCGTTCCTGGTCAAGCGGATCGACGGGGTG
CTGCACGTGCTGGCGCACGCCCGGGTCGAGCCGGGCTATCTCGATGTCGTGGAGCTGTCG
CCCACGGTCATGTGCACGCCCGGCAACTACGAGGGCCTGCCCGCCGCCGCCCGGCCGCCG
TTCCTCGGCGAGGTGCTCTCGGCCCGTCCCGAGCAGGTCCGCTTCGAGACGATCCTCTCC
GAGGAGGGCGGCCGGTTCTACCACGCGCAGAACCGGTACATCATCGTCGAGTCCGATATC
GACGTGGCGCCGGAACTGGCCTCGGAGTACCGCTGGATGGCGCTCCACCAGATGGTCGGC
CTGCTGCGGCACAGCCACTACGTCAACGTCCAGGCCCGCAGTCTGATCGCGTGTCTGCAC
AGCCTCTCGGGGGCGCAGGGGCGGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [35-239]  2.30000000000004e-82 PF03559 [273-479]  4.49999999999996e-84 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit