close all open/close all

CDS information : Vicen_00110


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction36,855 / 37,841 / + [in whole cluster]
36,855 / 37,841 / + [in contig]
Location36855..37841 [in whole cluster]
36855..37841 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)dTDP-4-keto-6-deoxyhexose 2,3-reductase
Gene
Gene (GenBank)vinE
EC number
Keyword
  • vicenisamine
  • axial-OH
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
Related Reference
ACC
Q9XC70
PmId
[16448097] A two-stage one-pot enzymatic synthesis of TDP-L-mycarose from thymidine and glucose-1-phosphate. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [dTDP-4-keto-6-deoxyhexose 2,3-reductase]
MLYRQLGRTALKVSPLCLGTLNLGVRTTRDEAFALMDEALEQGINFFDTANQYGWQVHKG
LTEEIIGEWFAQGGGRRERVVLGTKVCNPMSDLPNDQGLSARHIIASCEDSLRRLRTDWI
DVYQLHNIDPTASWDEVWQAMETLVHQGKIRYVGSSNFAGWHLADAQAAAARRNFLGLVS
EQCCYNLATRYVEMEVVPAARAHGIGVLAWSPLHGGLLSGALRKLDEGTAVKTAQGRAQI
ALRTMRDTVEQYEKLCESISADPSQVALAWLLSRPGLTAAVIGPRTTGHLASALETLDMT
LPEDILAPLDELFPPIGNGQPAPATWLA
selected fasta
>putative NDP-hexose C-3 ketoreductase [dTDP-4-keto-6-deoxyhexose 2,3-reductase]
ATGCTCTACCGGCAGCTCGGACGTACGGCACTGAAGGTCAGCCCGCTCTGTCTGGGCACC
CTCAACCTCGGCGTCCGTACCACCCGTGACGAGGCGTTCGCCCTCATGGACGAGGCCCTG
GAGCAGGGCATCAACTTCTTCGACACCGCCAACCAGTACGGCTGGCAGGTCCACAAGGGC
CTGACGGAGGAGATCATCGGAGAGTGGTTCGCACAGGGCGGCGGCCGGCGCGAGCGCGTG
GTCCTGGGCACCAAGGTCTGCAACCCGATGAGCGATCTGCCCAACGACCAGGGGCTGTCG
GCGCGGCACATCATCGCCTCCTGCGAGGACTCGCTACGGCGGCTGCGCACCGACTGGATC
GATGTCTACCAGCTCCACAACATCGACCCGACGGCGTCCTGGGACGAGGTGTGGCAGGCC
ATGGAGACCCTGGTGCACCAGGGCAAGATCCGTTACGTGGGGTCGTCCAACTTCGCGGGC
TGGCATCTGGCCGACGCGCAGGCCGCGGCGGCCCGCCGTAACTTCCTCGGACTCGTGTCG
GAGCAGTGCTGCTACAACCTGGCGACCCGGTACGTGGAGATGGAGGTCGTCCCCGCCGCG
CGGGCGCACGGCATCGGAGTGCTGGCCTGGTCGCCGCTGCACGGCGGTCTGCTGAGCGGG
GCGCTGCGCAAGCTGGACGAGGGGACGGCGGTGAAGACGGCCCAGGGCCGTGCGCAGATC
GCGCTGCGGACCATGCGGGACACCGTCGAGCAGTACGAGAAGCTGTGCGAGAGCATCTCC
GCCGACCCGTCCCAGGTTGCCCTGGCCTGGCTGCTGTCCCGGCCGGGTCTCACGGCCGCC
GTCATCGGCCCGCGCACCACCGGGCACCTGGCGAGCGCGCTGGAGACCCTGGACATGACG
CTGCCCGAGGACATCCTGGCGCCGCTGGACGAACTCTTCCCGCCGATCGGCAACGGTCAG
CCGGCGCCGGCCACCTGGCTCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [15-313]  1.20000000000001e-69 PF00248
PF00248   Aldo_ket_red
 [1-318]  1.79999754022378e-93 SSF51430
SSF51430   Aldo/ket_red
 [11-315]  1.10000000000001e-89 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
SignalP
 [1-34]  0.39 Signal
Bacteria, Gram-positive   
TMHMM No significant hit