close all open/close all

CDS information : Vicen_00120


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction38,001 / 38,498 / + [in whole cluster]
38,001 / 38,498 / + [in contig]
Location38001..38498 [in whole cluster]
38001..38498 [in contig]
TypeCDS
Length498 bp (165 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative glutamate mutase S chain
Product (GenBank)glutamate mutase S-chain
Gene
Gene (GenBank)vinH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[16161486] Involvement of glutamate mutase in the biosynthesis of the unique starter unit of the macrolactam polyketide antibiotic vicenistatin. (J Antibiot (Tokyo). , 2005)
Related Reference
ACC
Q7X542
PmId
[12543643] A glutamate mutase is involved in the biosynthesis of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative glutamate mutase S chain [glutamate mutase S-chain]
MPPHVRPMPDITSERLPDQDHHLPAERARPVLISSVASDSHTWNLVFLQLLIEELGHEVI
NLGPCVPDELLIAECRDRRPGLVVISTVNGHGYQDGLRVIGKLRACEDLANIPVVIGGKL
GVSGPGQSYAAELAGAGFDAVFPDGAEAVSSFTRYVEKLPQRVVS
selected fasta
>putative glutamate mutase S chain [glutamate mutase S-chain]
ATGCCGCCTCATGTCCGCCCGATGCCCGACATCACATCCGAACGGCTCCCGGACCAGGAC
CACCACCTGCCCGCCGAGCGTGCCCGGCCCGTGCTGATCAGCAGCGTCGCCTCCGACTCG
CACACCTGGAACCTGGTCTTCCTCCAACTGCTGATCGAGGAGCTGGGACACGAGGTCATC
AACCTCGGTCCCTGCGTGCCCGACGAACTGCTCATCGCCGAGTGCCGTGACCGCCGCCCC
GGCCTCGTCGTCATCAGCACCGTCAACGGCCACGGCTACCAGGACGGGCTACGGGTGATC
GGGAAACTGCGCGCCTGCGAGGACCTCGCGAACATCCCCGTCGTCATCGGCGGGAAGCTC
GGCGTCTCGGGCCCGGGTCAGTCGTACGCGGCCGAGTTGGCCGGCGCCGGGTTCGACGCG
GTGTTCCCCGACGGGGCGGAGGCCGTGTCCTCCTTCACCAGATACGTCGAGAAGCTCCCG
CAGCGAGTAGTGTCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [26-162]  6.79998707392904e-21 SSF52242
SSF52242   Cbl-bd
 [31-149]  1.1e-10 PF02310
PF02310   B12-binding
 [26-160]  2.2e-21 G3DSA:3.40.50.280
G3DSA:3.40.50.280   B12_bd
 [28-165]  PS51332
PS51332   B12_BINDING
SignalP No significant hit
TMHMM No significant hit