close all open/close all

CDS information : Vicen_00130


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction38,495 / 39,904 / + [in whole cluster]
38,495 / 39,904 / + [in contig]
Location38495..39904 [in whole cluster]
38495..39904 [in contig]
TypeCDS
Length1,410 bp (469 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productglutamate mutase E chain
Product (GenBank)glutamate mutase E-chain
Gene
Gene (GenBank)vinI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[16161486] Involvement of glutamate mutase in the biosynthesis of the unique starter unit of the macrolactam polyketide antibiotic vicenistatin. (J Antibiot (Tokyo). , 2005)
Related Reference
ACC
Q7X543
PmId
[12543643] A glutamate mutase is involved in the biosynthesis of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>glutamate mutase E chain [glutamate mutase E-chain]
MTGFGAYVRSVHRRGELVVQPRMGFSGTVEMRAGLAATRAADAATVGTITLDSYTRVGEL
AAAEEALRSGIALNGYPIVTYDESTTRELLAGIAGEDFPVQIRHGSATPLHIFGALTRAG
LDATEGGPVSYCLPYGRIPLEQSVTNWTRCCEEFARLRGLGREPHLETFGGCMLGQLCPP
SQLVAISMLEALFFHQHGIRSISLSYAQQTHQGQDEEAVLALRRLHRELLPDADCHIVIY
AYMGVYPTTPEGAHALLGRAAELAVATGAERLIVKTAAEAHRIPTIGENVAALEHAATVS
RAARRATALPAGHSAAPAATDPTAALTARPGTYADGSAALTAGPGAAADGSTDSAVYAEA
RALIEAVMNCGPDVGTALFRAFKRGYLDIPYCLHPDNMGRSRSYIDDTGRLQWAETGMLP
LGNARKSGTGRSVSSTDLISALSFVQRTYDQLAFPESREPLRIPRQQRP
selected fasta
>glutamate mutase E chain [glutamate mutase E-chain]
TTGACCGGATTCGGCGCCTACGTCCGCTCCGTCCACCGGCGCGGCGAACTCGTCGTCCAG
CCGCGGATGGGATTCAGCGGTACGGTCGAGATGCGCGCCGGTCTCGCCGCGACCCGGGCG
GCGGACGCGGCCACGGTCGGCACCATCACCCTGGACAGCTACACCCGGGTCGGGGAACTC
GCCGCAGCCGAGGAGGCACTCCGCTCCGGCATCGCCCTCAACGGCTACCCCATCGTCACC
TACGACGAATCCACCACCCGTGAACTCCTCGCCGGGATCGCGGGTGAGGACTTCCCCGTT
CAGATCCGGCACGGGTCGGCGACCCCCCTGCACATCTTCGGCGCGCTGACCCGCGCGGGC
CTGGACGCCACCGAGGGCGGCCCCGTCTCCTACTGCCTGCCCTACGGCCGGATTCCGCTG
GAACAGTCGGTGACCAACTGGACCCGCTGCTGCGAGGAGTTCGCCCGGCTGCGCGGGCTG
GGCCGTGAACCGCATCTGGAGACCTTCGGCGGCTGCATGCTCGGGCAGCTCTGCCCGCCC
AGCCAGCTCGTCGCCATCAGCATGCTCGAAGCGCTCTTCTTCCACCAGCACGGCATTCGC
AGCATCTCCCTCAGCTACGCCCAGCAGACCCATCAGGGACAGGACGAGGAAGCCGTGCTG
GCGCTGCGCCGGCTCCACCGCGAACTGCTGCCCGATGCCGACTGCCACATCGTCATCTAC
GCCTATATGGGGGTCTATCCGACCACCCCCGAGGGGGCCCACGCACTGCTGGGCCGGGCC
GCCGAACTCGCCGTCGCCACCGGGGCCGAGCGGCTCATCGTCAAGACCGCGGCCGAGGCC
CACCGCATCCCCACCATCGGGGAGAACGTGGCGGCCCTGGAGCACGCGGCCACCGTGTCC
CGCGCCGCCCGCCGGGCCACCGCGCTCCCGGCCGGTCACTCCGCTGCGCCCGCTGCCACC
GACCCCACCGCCGCGCTCACGGCCCGACCCGGTACGTACGCGGACGGATCCGCCGCGCTC
ACAGCGGGCCCCGGCGCCGCCGCGGACGGCTCCACCGACTCCGCCGTCTACGCGGAGGCC
CGCGCCCTCATCGAAGCCGTCATGAACTGCGGACCGGATGTCGGCACCGCACTGTTCCGC
GCTTTCAAGAGGGGATACCTGGACATCCCCTACTGCCTCCACCCCGACAACATGGGCCGC
AGCCGGAGTTACATCGACGACACCGGGCGGCTGCAATGGGCGGAGACCGGAATGCTGCCC
CTGGGGAATGCCAGAAAAAGCGGAACAGGCCGCTCGGTATCGTCAACCGATCTGATATCG
GCCCTTTCCTTCGTGCAGCGGACCTATGACCAACTGGCATTTCCGGAATCCCGGGAGCCG
CTCCGGATACCCCGGCAGCAGCGCCCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006396 Glutamate mutase, E subunit (Family)
 [4-305]  3.99999999999998e-86 PF06368 [352-424]  7.4e-12 PF06368
PF06368   Met_asp_mut_E
 [1-467]  2.80000504261099e-129 PIRSF001495
PIRSF001495   Met_asp_mut_epsi
IPR014348 Cobalamin (vitamin B12)-dependent enzyme, catalytic subdomain (Domain)
 [4-312]  9.39999999999981e-114 G3DSA:3.20.20.240 [348-400]  9.39999999999981e-114 G3DSA:3.20.20.240
G3DSA:3.20.20.240   Cobalamin-dep_enz_cat
IPR016176 Cobalamin (vitamin B12)-dependent enzyme, catalytic (Domain)
 [4-465]  1.09999184471405e-126 SSF51703
SSF51703   Cbl-dep_enz_cat
SignalP No significant hit
TMHMM No significant hit