close all open/close all

CDS information : Vicen_00140


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction39,990 / 40,889 / + [in whole cluster]
39,990 / 40,889 / + [in contig]
Location39990..40889 [in whole cluster]
39990..40889 [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productamidohydrolase
Product (GenBank)proline iminopeptidase
Gene
Gene (GenBank)vinJ
EC number3.5.1.-
Keyword
  • deprotection
  • S33 family peptidase
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)
[24530530] The crystal structure of the amidohydrolase VinJ shows a unique hydrophobic tunnel for its interaction with polyketide substrates. (FEBS Lett. , 2014)
Related Reference
ACC
Q76KX0
PmId
[15066172] S-stereoselective piperazine-2-tert-butylcarboxamide hydrolase from Pseudomonas azotoformans IAM 1603 is a novel L-amino acid amidase. (Eur J Biochem. , 2004)

close this sectionSequence

selected fasta
>amidohydrolase [proline iminopeptidase]
MSKPPSAKGTVPFGQYRTWYRVTGDLHSGKPPVVLLHGGPGSTHDYLLAMTSLTEAGWPV
VHYDQLGNGGSTHLPEKGEDFWTVQLFEDELDNLLNQLGIAGDYVLFGQSWGGMLGSVHA
ARRPAGLRGLVVANAPASMKIWLQEMARLRALLPPDVQETLLKHEAARTTDTEEYFHAMR
AFYDRHVCRIVPWPRDFAATFMEIYNDPTVYTTMNGPNEFHVIGTLRDWSVEDCLPDIQV
PTMVLIGRHDEATPATVKPFLDLVPDVRYEVLENSSHVPHLEEPERFHEVMIDYLESLV
selected fasta
>amidohydrolase [proline iminopeptidase]
ATGTCCAAGCCCCCGAGTGCCAAGGGGACTGTGCCGTTCGGTCAATACCGGACGTGGTAT
CGGGTAACGGGCGATCTGCATTCCGGTAAACCACCGGTGGTGCTGTTGCACGGTGGTCCC
GGCTCCACCCACGACTACCTGCTGGCCATGACCTCCCTCACCGAAGCCGGCTGGCCCGTC
GTCCACTACGACCAGCTCGGCAACGGCGGATCCACCCACCTCCCCGAGAAGGGCGAGGAC
TTCTGGACCGTCCAGCTCTTCGAGGACGAACTGGACAACCTCCTCAACCAGCTCGGCATA
GCCGGCGACTACGTGCTCTTCGGCCAGTCCTGGGGCGGGATGCTCGGCTCGGTGCACGCC
GCCCGCCGCCCCGCCGGACTGCGCGGCCTCGTCGTCGCCAACGCACCCGCCTCCATGAAG
ATCTGGCTCCAGGAGATGGCGCGGCTGCGCGCACTGCTCCCGCCCGACGTGCAGGAGACC
CTCCTCAAGCACGAGGCGGCGCGGACCACGGACACCGAGGAGTACTTCCACGCCATGCGG
GCCTTCTACGACCGGCACGTCTGCCGGATCGTGCCCTGGCCCCGGGACTTCGCCGCCACC
TTCATGGAGATCTACAACGACCCGACGGTCTACACGACCATGAACGGGCCGAACGAGTTC
CATGTGATCGGCACCCTGCGCGACTGGTCCGTCGAGGACTGCCTGCCCGACATCCAGGTG
CCCACCATGGTCCTCATCGGCCGTCATGACGAGGCCACCCCCGCGACCGTCAAGCCCTTC
CTCGACCTCGTGCCCGACGTCCGGTACGAGGTGCTGGAGAACTCCAGCCACGTACCGCAC
CTGGAGGAGCCCGAGCGGTTCCACGAGGTGATGATCGACTACCTCGAAAGCCTGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002410 Peptidase S33 (Family)
 [33-41]  1.49999977583352e-10 PR00793 [60-71]  1.49999977583352e-10 PR00793 [106-120]  1.49999977583352e-10 PR00793
PR00793   PROAMNOPTASE
IPR005945 Proline iminopeptidase/L-amino acid amidase (Family)
 [9-295]  5.90000000000008e-72 TIGR01250
TIGR01250   Pro_imino_pep_2
 [2-299]  PIRSF005539
PIRSF005539   Pept_S33_TRI_F1
SignalP
 [1-7]  0.442 Signal
Bacteria, Gram-negative   
TMHMM No significant hit