close all open/close all

CDS information : Vicen_00150


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction40,886 / 41,869 / + [in whole cluster]
40,886 / 41,869 / + [in contig]
Location40886..41869 [in whole cluster]
40886..41869 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productalanine-3-amino-2-methylpropionyltransferase
Product (GenBank)malonyl-CoA-[acyl-carrier-protein] transacylase
Gene
Gene (GenBank)vinK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)
[26831085] Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis. (Proc Natl Acad Sci U S A. , 2016)
Related Reference
ACC
P0AAI9
PmId
[1314802] Cloning, nucleotide sequence, and expression of the Escherichia coli fabD gene, encoding malonyl coenzyme A-acyl carrier protein transacylase. (J Bacteriol. , 1992)

close this sectionPKS/NRPS Module

0
AT46..138

close this sectionSequence

selected fasta
>alanine-3-amino-2-methylpropionyltransferase [malonyl-CoA-[acyl-carrier-protein] transacylase]
MNATVETTQHDVEGTGAAGATAMLFPGMGPAAFSDVGRFMVTNRYTRELLAEADDTLGYS
LVDRFRQAEGDYSEYAQIAFLVNCVALARWAEQTMDLTPRICAGASFGEKSVAAYSGALT
FADAVRMTAGLARCMDEYFRTEHLGVVTHSFVRAPRERLDEILAELDERGEWHEISCHID
HDFFMLTLHERNSVWLEGRLRSVGAMPLYAMRPPMHAAAFGGLRDKAEEEVIAPLTFHDP
TLPVVADQDGKVLTTGDEVRTMLLESFVRPLRWPDVISSLQDQGVTRVCVAGPDSLFGRV
GTTTRAFEVIAATPRLALQPRARTTSR
selected fasta
>alanine-3-amino-2-methylpropionyltransferase [malonyl-CoA-[acyl-carrier-protein] transacylase]
GTGAACGCGACCGTGGAGACGACACAGCACGACGTCGAGGGGACCGGCGCGGCCGGCGCG
ACCGCGATGCTCTTCCCCGGGATGGGACCCGCCGCGTTCTCCGACGTCGGCCGGTTCATG
GTGACCAACCGGTACACCAGGGAACTCCTCGCGGAGGCCGACGACACCCTCGGCTACTCC
CTCGTCGACCGGTTCCGGCAGGCCGAGGGCGACTACTCCGAGTACGCCCAGATCGCCTTC
CTGGTCAACTGCGTCGCCCTCGCCCGCTGGGCCGAGCAGACCATGGACCTCACCCCCCGG
ATCTGCGCCGGAGCCAGCTTCGGCGAGAAGTCCGTCGCCGCCTACAGCGGCGCCCTCACC
TTCGCCGACGCCGTCCGGATGACCGCCGGCCTCGCCCGCTGTATGGACGAGTACTTCCGT
ACGGAGCACCTCGGGGTCGTCACCCACTCCTTCGTCCGCGCCCCTCGGGAGCGGCTCGAC
GAGATCCTCGCCGAACTCGACGAGCGCGGCGAATGGCACGAGATCTCCTGCCACATCGAC
CACGACTTCTTCATGCTCACCCTCCATGAACGCAACAGTGTCTGGCTGGAGGGCCGGCTC
CGGTCGGTGGGCGCCATGCCGCTGTACGCCATGCGGCCCCCGATGCACGCCGCCGCCTTC
GGCGGGCTGCGCGACAAGGCCGAGGAGGAGGTCATCGCCCCCCTCACCTTCCACGACCCG
ACCCTGCCCGTCGTCGCCGACCAGGACGGCAAGGTGCTGACCACCGGCGACGAGGTGCGC
ACCATGCTCCTGGAGAGCTTCGTCCGCCCGCTGCGCTGGCCCGACGTCATCTCCTCGCTC
CAGGACCAGGGCGTCACCCGCGTCTGTGTCGCGGGCCCCGACAGCCTCTTCGGGCGGGTC
GGCACCACCACCCGCGCCTTCGAGGTCATCGCGGCGACCCCGCGGCTCGCCCTCCAGCCC
CGCGCGCGCACCACCTCGCGCTGA
[0] AT46..138
[0] AT136..414

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [19-138]  2.2e-26 G3DSA:3.40.366.10 [213-300]  2.2e-26 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [46-138]  1.3e-05 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [20-311]  2.90000354677981e-28 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
SignalP No significant hit
TMHMM No significant hit