close all open/close all

CDS information : Vicen_00160


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction41,987 / 42,235 / + [in whole cluster]
41,987 / 42,235 / + [in contig]
Location41987..42235 [in whole cluster]
41987..42235 [in contig]
TypeCDS
Length249 bp (82 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productpeptidyl carrier protein
Product (GenBank)acyl-carrier-protein
Gene
Gene (GenBank)vinL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)
[26831085] Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis. (Proc Natl Acad Sci U S A. , 2016)

close this sectionPKS/NRPS Module

0
PCP2..59

close this sectionSequence

selected fasta
>peptidyl carrier protein [acyl-carrier-protein]
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALT
KETFETPGVLWKTLSQMVEPRH
selected fasta
>peptidyl carrier protein [acyl-carrier-protein]
ATGTGGGACGCCCAGTTCGAGAACCTCCTCCGCCGCTACCTCCCGTTCCTCTCCGCCGAC
CAGCCGCTGGAGCAGGACATCAACCTGCGTGACATCGGCCTCGACTCGCTCGGCACCGTC
GAGCTGCTCTCCGAGCTGGAGAACACCTACGACGTCCACTTCCAGGACGAGGCGCTCACC
AAGGAGACCTTCGAGACCCCCGGCGTGCTCTGGAAGACCCTCTCCCAGATGGTCGAGCCG
CGCCACTGA
[0] PCP2..59
[0] PCP4..177

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [31-46]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1-78]  1.59999889349252e-10 SSF47336
SSF47336   ACP_like
 [8-58]  2.7e-07 PF00550
PF00550   PP-binding
 [2-59]  PS50075
PS50075   ACP_DOMAIN
 [8-79]  5.8e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP No significant hit
TMHMM No significant hit