close all open/close all

CDS information : Vicen_00170


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction42,289 / 43,863 / + [in whole cluster]
42,289 / 43,863 / + [in contig]
Location42289..43863 [in whole cluster]
42289..43863 [in contig]
TypeCDS
Length1,575 bp (524 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Product3-amino-2-methylpropionyl-PCP--alanine ligase
alanine-3-amino-2-methylpropionyl-PCP synthetase
Product (GenBank)non-ribosomal peptide synthetase
Gene
Gene (GenBank)vinM
EC number
Keyword
  • protection
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)

close this sectionSequence

selected fasta
>3-amino-2-methylpropionyl-PCP--alanine ligase [non-ribosomal peptide synthetase]
MHAADHALHARFLRGLACAPDRPAVRFGGRTLTYAQAHRTALTWAGSLLRATPEPPAAVG
VLADKGIPAYLGILTALYAGAAVVPLRPDFPAARTAEMMRAAGVTAVIADGRGRRLLPEL
LADRRDTAVLAADEEGAPADESPADGSAPGRRVAIDEGYALTAPRDVVPDDTAYVLFTSG
STGRPKGVPLSHGNIAHYFEVLDARYDFTADDVFTQTFDLNFDCSLFDLFCAWGAGASVI
QIPPQAYRDLPSHLAEQGVTVWFSTPSSIALVRRLGGLAPGSLPTLRWSFFAGEALKCAD
TEDWQRAAPASFVENLYGPTELTVTVTAHRWSPEVSPVVGANGVVPIGPLHKGLDHVLID
AGGLPHPDTGELCVTGPQMAGRYLDPADDHGRFLDHDGRRWYRTGDRVRLAPGGELVYLG
RMDAQVQIQGWRVELAEVDHALQGCEGVGEAVTVGAATDAGTELVVFYTAPAPVPPVRFA
AVLRATLPDGVVPRHYRHVAELPLNSNRKIDRRALTARAEELLG
selected fasta
>3-amino-2-methylpropionyl-PCP--alanine ligase [non-ribosomal peptide synthetase]
ATGCACGCCGCCGACCACGCCCTGCACGCCCGCTTCCTGCGCGGGCTCGCCTGCGCGCCC
GACCGGCCCGCCGTACGGTTCGGCGGGCGGACCCTGACGTACGCGCAGGCCCACCGCACC
GCCCTGACCTGGGCGGGTTCCCTGCTGCGCGCCACGCCGGAGCCCCCGGCCGCCGTCGGT
GTCCTCGCCGACAAGGGCATCCCCGCCTATCTGGGCATCCTGACCGCGCTCTACGCCGGC
GCCGCCGTCGTGCCGCTGCGGCCGGACTTCCCCGCGGCCCGTACCGCCGAGATGATGCGG
GCCGCGGGGGTCACCGCCGTCATAGCCGACGGTCGTGGCCGGCGGCTGCTCCCCGAACTG
CTCGCCGACCGCCGGGACACCGCCGTCCTGGCCGCCGACGAGGAAGGCGCCCCCGCCGAC
GAGAGCCCCGCCGACGGGAGCGCCCCGGGCCGCCGTGTCGCGATCGACGAGGGGTACGCG
CTCACCGCGCCCCGGGACGTCGTCCCGGACGACACCGCGTACGTCCTCTTCACCTCCGGC
TCCACCGGGCGGCCCAAGGGCGTGCCGCTCAGCCACGGCAACATCGCCCACTACTTCGAG
GTCCTCGACGCCCGCTACGACTTCACCGCGGACGACGTCTTCACCCAGACCTTCGACCTC
AACTTCGACTGCTCGCTCTTCGACCTGTTCTGCGCCTGGGGCGCCGGCGCGAGCGTCATC
CAGATCCCGCCCCAGGCATACCGGGACCTGCCGTCCCACCTCGCCGAACAGGGCGTCACC
GTCTGGTTCTCCACCCCGAGCAGCATCGCGCTGGTGCGCCGGCTCGGCGGTCTGGCACCC
GGCTCACTGCCCACCCTGCGCTGGAGCTTCTTCGCGGGCGAGGCACTCAAGTGCGCCGAC
ACGGAGGACTGGCAGCGCGCCGCGCCCGCCTCCTTCGTGGAGAACCTGTACGGCCCCACC
GAACTCACCGTCACCGTCACCGCCCACCGCTGGTCCCCGGAGGTCTCCCCGGTCGTCGGC
GCCAACGGCGTCGTCCCCATCGGCCCCCTCCACAAGGGCCTGGACCACGTCCTGATCGAC
GCCGGTGGACTGCCCCACCCCGACACCGGGGAACTCTGCGTCACCGGACCCCAGATGGCG
GGCCGCTACCTCGACCCCGCCGACGACCACGGCCGCTTCCTCGACCACGACGGGCGCCGC
TGGTACCGCACCGGGGACCGGGTCCGACTGGCCCCCGGCGGGGAACTCGTCTACCTCGGC
CGGATGGACGCCCAGGTCCAGATCCAGGGCTGGCGGGTGGAGCTCGCCGAGGTCGATCAC
GCCCTCCAGGGGTGCGAGGGCGTCGGCGAGGCCGTCACCGTCGGCGCCGCCACCGACGCG
GGCACCGAGCTGGTCGTCTTCTACACGGCCCCCGCCCCGGTGCCGCCCGTCCGCTTCGCC
GCCGTGCTGCGCGCCACCCTGCCCGACGGTGTCGTACCACGGCACTACCGCCATGTCGCC
GAACTGCCGTTGAATTCCAACCGCAAGATCGACCGGCGAGCACTGACCGCACGTGCCGAG
GAACTCCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [33-452]  9.9e-80 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [175-186]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit