close all open/close all

CDS information : Vicen_00180


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction44,156 / 45,592 / + [in whole cluster]
44,156 / 45,592 / + [in contig]
Location44156..45592 [in whole cluster]
44156..45592 [in contig]
TypeCDS
Length1,437 bp (478 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Product3-methylaspartate--PCP ligase
3-methylaspartyl-PCP synthetase
Product (GenBank)non-ribosomal peptide synthetase
Gene
Gene (GenBank)vinN
EC number
Keyword
Note
  • VinN recognizes (2S,3S)-3-methylaspartate as a beta-amino acid substrate and adenylates the carboxyl group at the C4 position.
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)
[25246523] The crystal structure of the adenylation enzyme VinN reveals a unique beta-amino acid recognition mechanism. (J Biol Chem. , 2014)

close this sectionPKS/NRPS Module

0
A9..410

close this sectionSequence

selected fasta
>3-methylaspartate--PCP ligase [non-ribosomal peptide synthetase]
MEDAFGTWTYQELLNHSQAFSAWLDGKGVARGERIVVQLPNIRQTVAVFYGACRRGVVFV
PLNPGMKPFHLRSVIADADPRLVIAEDETAADRLRDVTDLPVYSIDSLWADVERLRDAGA
GAEAVEVSPEDLAVLIYTSGSTAAPKAVACPHQQIVFAASSINAVLGYHAEDIVFCRMSV
SWDFGLYKVLISTLTGAKLVLAGGEPDIALVKSLRESGATMMPIVPSLASMLTTLIRRDP
EGAPTLRMFTNSAAALPQVTIDALRSAFPGAQVVRMYGQTECKRISIMPPHLEHERPDSV
GLPLPGTTIEILDEDGTLLPPGEPGEITVTGPHVMAGYWRAPEITARAYRRDETTGAMRL
HTGDYGHLDEDGFLYFGGRRDDMFKRKGTRMSTVEIEAAALDIPGVTAAVALPPTATRDL
ALCVASDLEPHDVLRSLAERLEPAKVPATCRIVNDFPLTLNGKSERKQLARLLDGSDK
selected fasta
>3-methylaspartate--PCP ligase [non-ribosomal peptide synthetase]
ATGGAAGACGCATTCGGAACCTGGACCTATCAAGAGCTGCTGAACCATAGTCAGGCATTC
AGCGCCTGGCTGGACGGAAAGGGCGTCGCCCGCGGCGAACGCATCGTCGTCCAGCTCCCG
AACATCCGCCAGACGGTCGCCGTGTTCTACGGAGCCTGCCGCCGCGGCGTCGTGTTCGTC
CCGCTCAACCCGGGCATGAAGCCCTTCCACCTGCGGTCCGTCATCGCCGACGCCGACCCG
CGCCTGGTCATCGCCGAGGACGAGACCGCGGCCGACCGGCTGCGTGACGTCACCGACCTG
CCGGTGTACTCCATCGACTCCCTCTGGGCGGATGTCGAGCGGCTGCGCGACGCGGGCGCC
GGAGCCGAGGCCGTCGAGGTCTCCCCGGAGGATCTGGCCGTCCTCATCTACACCTCCGGC
TCCACCGCGGCCCCCAAGGCGGTCGCCTGCCCCCACCAGCAGATCGTGTTCGCCGCCTCC
TCGATCAACGCCGTACTCGGCTACCACGCCGAAGACATCGTCTTCTGCCGGATGTCGGTC
TCCTGGGACTTCGGTCTCTACAAGGTGCTGATCTCCACCCTCACCGGCGCCAAGCTCGTC
CTCGCGGGCGGTGAGCCCGACATCGCGCTCGTCAAGTCCCTCCGCGAGAGCGGCGCCACG
ATGATGCCCATCGTGCCGTCCCTGGCGAGCATGCTCACCACCCTCATCCGGCGCGACCCC
GAGGGCGCCCCGACGCTGCGGATGTTCACCAACAGCGCCGCCGCGCTGCCCCAGGTCACC
ATCGACGCCCTGCGCTCCGCGTTCCCCGGCGCCCAGGTCGTGCGCATGTACGGCCAGACC
GAGTGCAAGCGCATCTCGATCATGCCGCCGCATCTGGAGCACGAGCGACCCGACTCCGTC
GGTCTGCCGCTGCCCGGCACCACCATCGAGATCCTGGACGAGGACGGCACCCTCCTGCCG
CCCGGTGAGCCCGGCGAGATCACCGTCACCGGACCCCATGTCATGGCCGGCTACTGGCGC
GCGCCCGAGATCACCGCCCGCGCCTACCGCCGCGACGAGACCACCGGCGCGATGCGCCTG
CACACCGGCGACTACGGCCACCTCGACGAGGACGGATTCCTCTACTTCGGCGGCCGGCGC
GACGACATGTTCAAGCGCAAGGGCACCCGGATGAGCACCGTCGAGATCGAGGCCGCGGCC
CTCGACATCCCCGGCGTCACCGCCGCCGTGGCGCTGCCCCCGACCGCCACCCGGGACCTG
GCCCTGTGTGTCGCGTCCGACCTCGAACCCCATGACGTCCTCCGCAGCCTCGCGGAGCGG
CTCGAACCGGCGAAGGTCCCCGCGACCTGCCGTATCGTCAACGACTTCCCGCTCACCCTG
AACGGCAAGTCCGAGCGCAAGCAGCTCGCACGCCTGCTCGACGGGAGCGACAAGTGA
[0] A9..410
[0] A25..1230

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [9-410]  5.80000000000004e-96 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit