close all open/close all

CDS information : Vicen_00190


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction45,589 / 46,833 / + [in whole cluster]
45,589 / 46,833 / + [in contig]
Location45589..46833 [in whole cluster]
45589..46833 [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Product3-methylaspartyl-PCP decarboxylase
Product (GenBank)decarboxylase
Gene
Gene (GenBank)vinO
EC number4.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)

close this sectionSequence

selected fasta
>3-methylaspartyl-PCP decarboxylase [decarboxylase]
MNQYEELADQYGTPLYVYDLDRVAEARHDLRTSLPDEVEIYYALKANPHPQVAGALRSGE
GRECRAEISSVGELAAALTAGFRASEILYTGPGKTDGELDEAIGKGVKTFCVESLTDLQH
VGAVALRHGVVADCLLRINSATASATTSIRMTGTPSQFGIDSETLVDAMPELRAVPGTRI
TGLHFFPLSNARDEASLIGEFRHTIAYAAGLAEETGLTLEFLDIGGGFAHPYGAPGERPV
YRELRTELAAALDEHFPHWREGAPRIAVETGRYQTSGAGTLLTRVVNIKVSRGRKFVVID
AGINTFGGMSGLGRLLPVAVEPEYTGSAEATELTDVASLAGPLCTPGDILGREIRLPELA
PGDLVTIPNAGAYGVTASLLMFLGRPAPVEVVLKGGKVVSASRLEHHRTPATPG
selected fasta
>3-methylaspartyl-PCP decarboxylase [decarboxylase]
GTGAACCAGTACGAAGAACTCGCCGACCAGTACGGCACCCCGCTCTACGTCTACGACCTC
GACCGCGTCGCCGAGGCCCGGCACGATCTGCGCACCTCACTGCCCGACGAGGTCGAGATC
TACTACGCCCTCAAGGCCAACCCCCACCCGCAGGTCGCCGGCGCCCTGCGCAGCGGCGAG
GGCCGCGAGTGCCGCGCCGAGATCAGCTCCGTCGGCGAGCTGGCCGCCGCCCTCACCGCC
GGCTTCCGTGCCTCCGAGATCCTCTACACCGGCCCCGGCAAGACCGACGGCGAACTGGAC
GAAGCGATCGGCAAGGGCGTCAAGACCTTCTGCGTCGAATCGCTGACCGACCTCCAGCAC
GTCGGCGCCGTCGCCCTGCGACACGGCGTCGTCGCCGACTGCCTGCTGCGCATCAACAGC
GCCACCGCCAGCGCCACCACCAGCATCCGGATGACCGGAACCCCCTCACAGTTCGGCATC
GACAGCGAGACCCTCGTCGACGCCATGCCCGAACTGCGCGCCGTACCCGGCACCCGGATC
ACGGGCCTGCACTTCTTCCCCCTCAGCAACGCGAGGGACGAGGCCAGCCTCATCGGCGAG
TTCCGCCACACCATCGCCTACGCGGCCGGCCTCGCCGAGGAGACCGGTCTCACCCTGGAA
TTCCTCGACATCGGCGGCGGCTTCGCCCACCCCTACGGCGCGCCCGGCGAGCGCCCCGTC
TACCGCGAACTCCGCACCGAGCTGGCCGCCGCCCTCGACGAGCACTTCCCGCACTGGCGC
GAGGGCGCCCCGCGCATCGCGGTGGAGACCGGCCGCTACCAGACCAGCGGCGCCGGAACC
CTGCTCACCCGGGTCGTCAACATCAAGGTCAGCCGGGGCCGGAAGTTCGTCGTCATCGAC
GCCGGGATCAACACCTTCGGCGGTATGTCCGGCCTCGGCCGGCTGCTGCCGGTCGCCGTC
GAACCCGAGTACACCGGCTCCGCCGAAGCCACCGAACTCACCGATGTCGCCAGCCTCGCC
GGCCCCCTCTGCACCCCCGGTGACATCCTCGGCCGCGAGATCCGCCTGCCCGAACTGGCC
CCCGGCGACCTCGTGACCATCCCCAACGCGGGCGCGTACGGCGTCACCGCGAGCCTGCTG
ATGTTCCTCGGCAGGCCCGCGCCGGTCGAGGTCGTCCTGAAGGGCGGCAAGGTCGTCTCC
GCGTCCCGACTGGAGCACCACCGCACTCCGGCGACCCCCGGATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009006 Alanine racemase/group IV decarboxylase, C-terminal (Domain)
 [261-399]  5.09999999999998e-31 G3DSA:2.40.37.10
G3DSA:2.40.37.10   Ala_racemase/Decarboxylase_C
 [247-403]  4.79998722798115e-37 SSF50621
SSF50621   Racem_decarbox_C
IPR022643 Orn/DAP/Arg decarboxylase 2, C-terminal (Domain)
 [280-392]  8.1e-14 PF00278
PF00278   Orn_DAP_Arg_deC
IPR022644 Orn/DAP/Arg decarboxylase 2, N-terminal (Domain)
 [21-275]  6.09999999999996e-33 PF02784
PF02784   Orn_Arg_deC_N
SignalP No significant hit
TMHMM No significant hit