close all open/close all
Vicen_00190 Vicen_00190   last last

CDS information : Vicen_00200


close this sectionLocation

Organism
StrainHC34
Entry nameVicenistatin
Contig
Start / Stop / Direction47,012 / 64,492 / + [in whole cluster]
47,012 / 64,492 / + [in contig]
Location47012..64492 [in whole cluster]
47012..64492 [in contig]
TypeCDS
Length17,481 bp (5,826 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 1-3
Gene
Gene (GenBank)vinP1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

0
1 malonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
ACP41..114
KS137..513
AT668..989
DH1035..1194
ER1526..1831
KR1841..2019
ACP2122..2192
KS2220..2595
AT2749..3063
DH3109..3272
KR3592..3770
ACP3873..3943
KS3966..4342
AT4499..4832
DH4881..5045
KR5386..5566
ACP5671..5741

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 1-3]
MSESENPVSATTAGADETPDTRTALARRLAGLSPAEQEQHLVDMVHRHTVAALQAVAPLT
PDQVDVQRPFLELGFDSLAAVDLHKRLTGETGLELPVTVAFDFPTPVLVAEEIRRIAFGI
RPAPLAPVVATGNLDDDPIAIIGIGCRFPGGINSAEELWQLVMDEAEVLSGFPTNRGWDV
EGIYDPDPGKPGKSYVREGGFLQDAGDFDADFFGISPREALAMDPQQRLVLETAWEAFER
AGIDPGSLHGSKAGVFIGAEVHEYGTRVHEAPEGLDGYLMTGNAPSVASGRIAYSLGLEG
PAVTIDTACSGSLVALHLAAHSLRQGESSLAIAGGVTVMGNPGMFAAFSRQRGLAADGRC
KPFAAAADGTGFSEGVGVFVVERLADARRNGHPVLGIVKGSAINQDGASNGLTAPNGPSQ
QRLILQALANAGLKPADVDTMEAHGTGTKLGDPIEAQAILATYGQEREEGRPLWLGSIKS
NLGHTQAAGGAASLIKMLMGMRHGKLPRSLHIDAPTPHVDWTTGDVALLTETRDWDAPDR
PRRAGVSAFGISGTNAHVIIEEAPEFEPSAVEPVAGSGVTPPWVLSARSADALRGQAERL
LSFVSTDADVSVVDVAYSLGVSRAGLEHRGVVLGESREELIAALESLASGAEAPGVVTGR
VAEGRLAFLFTGQGAQRVGMGRELAAEFPVFAASLEETCDLLDVGLEDQDHSLREVLFAE
EGSAEAALLTRTVYAQAALFAVEVALFRLVESFGVVPDFVAGHSVGEIAAAHVAGVFSLE
DATMLVAARGRLMDALPEGGTMVAVQATEEDVLALLEGVEDASIAAINGPDAVVVSGTET
GVARVVDVLRDRGAKTKRLDVSHAFHSPLMEPMLTEFRRVAEVLEYQAPRIAVVSNVSGS
VAGTELATPEYWVTHVREAVRFSAGVRTLLGAGVSSFLEIGPDGVLSGMARGSVSDGADV
GCVPVMRRGRGEVREFLTGLSRIAVRGVPVTWEPLIEGARRVELPTYAFQRRWFWLEAGR
STTDALGLGQTAAEHPLVGAVVGLAGGDGVVLTGRVSLHTHPWLADHQVAGVTLLPGTGF
VELAVRAGDEVGCGRLEELTLEAPLVVPDRGAVQLQVVVGALEESDVRTVSVYSRAEEDD
VWTRHATGFVGAAVDGGLNLEAWPPPGARAVDVSDVYAGLADQGYGYGPVFQGLRSVWRG
DGEVFAEVVLPEGAQADASAFGLHPALLDAALHATDYLDPESAVEGTHLPFAWTGVSLHA
TGASELRVRITATGNDGYALDLADTTGRPVATVQSLVLRPVTEEQLRSAQGGNGPDSLFR
VEWAPVTADLTASGAGWAVLGAGAPELAAALTAAGTPGTAYHGTAELSAAVDGGTTPDVV
AVQLPSAGAADADLPDAVRATLNTALEFVQNWLADERLAETRLVVVTRDAVTVDTAAGGP
DLTVAPVWGLIRSAQAENPGRILLADIDGTDQSRTALAAITAADEPELAFRNGNAYAPRL
VRSVSEGGLVPPSDAASWRLDVLSQGTLENLALIPSDADERTLAPGEVRIAVRAAGVNFR
DVLVALGMYPTKADIGGEAAGLVLEVGPGVTDFTPGDRVMGLFDTAFGPHAITDHRTLVP
MPTGWTYAQAATAPLVFATAYYGLVDLAELRSGESALIHAAAGGVGMAAVQIARHLGAEV
YGTASPGKWNALRAAGLDDNHIASSRDTTFEQKFLANSGGRGVDVVLDALTGEFIDASLR
LLPRGGRFAEMGKTDVRDPERVAAEYPGVRYRAFDLFEADLDRLREILRELLALFESGAL
RPLPVRAWDIRKSKDAFRHIAQARHIGKVALTMPTGGLGDGVVLVTGGTGGLGALVARHV
VVVHGVRRLVLVSRRGLGAPGAVGLVAELEGLGAVVEVVACDVSDRVALAGVVGGIGSDL
SAVVHTAGVVDDGVVGSLSVGRLSSVLGPKADAAWYLHELTVGLDLSAFVLFSSVAGVVD
GAGQGNYAAANVFLDGLAVVRRGLGLPGTSVAWGLWEGAGMGAVLGEADVLRMSRSGVLG
LSVGEGLGLFDVALGEDVAALVPVRLDLGALRSRVDGVPAVFRSLVRVPVRRSVGVGVSG
GGEVSLERRLVVLDAGERERVLLELVRSHVAAVLGYEGAGSIEPGRAFSDIGFDSLSAVE
LRNRLNGETGLRLPATLIFDYPTPQALAEYVIVALLGEEAANAPALPPTEAPTVTGTDDD
PVVIVGMGCRFPGDVRTPEDLWRLVSNGSDAVTPFPDNRAWDIEGIYDPLPGVSGKTYAR
EGGFLHDAAEFDPEFFGISPREALAMDPQQRLLLETSWEAIERAGIDPNSLRGTQTGVFA
GVMQTDYGNGGARLAEDVEGYIANGTLGSIVSGRVSYALGLEGPAVTIDTACSSSLVAMH
WAAHALRQGECSLALAGGVTVMSTPETFVDFSLQRGLAPNGRCKAFSADADGTGWGEGVG
VLVLERLSDARRNGHQVLAVIRGSALNQDGASNGLTAPNGPSQQRVIRQALVSAGLTTSD
VDAVEAHGTGTTLGDPIEAQALLATYGQERDADQPLWLGSVKTNVGHTQAAAGVAGVIKM
VLAMRAGVLPKTLHVTEPSPHVDWSAGAVELLTETRDWPETGRPRRAGVSSFGVSGTNAH
VIVEQAPAVEEEPTRALPALPVPWSISAKSADALRGQAQALSSFVSAAGDVSVVDVAYSL
GVSRAGLEHRGVVVGESRAELLVALESLASGVESPGVVTGRVAEGRLAFLFTGQGAQRVG
MGRELAAEFPVFAASLEQTCDLLERAGVAVREVLFAEEGSAEAALLTRTVYAQAALFAVE
VALFRLVESFGVVPDFVAGHSVGEIAAAHVAGVFSLEDAVSLVAARGRLMDALPEGGAMV
AVQATEEDVLALLEGVEDASIAAINGPDAVVVSGTETGVARVVDVLRERGAKTKRLVVSH
AFHSPLMEPMLADFATVVEGLSYKAPAIPVVSGSVVGSELSTPGYWVRHVREAVRFGAGV
ETLLGAGVSSFLEIGPDGVLSGMARTSVPEGADVECAPLMRRDRAEVREFLTGLSRLAVR
GVPVAWESLVEGGRRVELPTYAFQRRRFWLEAGRSVTDASGLGQTAAEHPLVGAVVGLAG
GDGVVLTGRVSLHTHPWLADHQVAGVTLLPGTGFVELAVRAGDEVGCGRLEELTLEAPLV
VPDRGAVQLQVVVGALETSGVRTVSVYSRVEEESADDTWVRHATGALMAAAEEPGFDLTA
WPPAGARAVDVSDAYAGLASQGYGYGPVFQGLTAAWRKGREVFAEITLPEAAQVDASAFG
LHPALLDAALHATDYLDQESAEGTHLPFAWSGVSLHAAGASALRVRIVATGKDGYALDLA
DSTGRPVATVQSLVTRPVTADQLSEASATQHQSLFRMEWTATTAPAATADVRWALLGEPV
AELGDLAGFGRTTAYASLADLAAADADTVPDLVVLPLGSRMAEGSDVPEAVRENLGQVLA
TIQQWNDDSRFDGSRLVVLTHGAVSVSDDESLTALDLAPVWGLVRSAMAETPGRFLLVDT
DGTDPSTDALRHLAELQEAEFALREGEIRVPRLARVPVAGAGADITGGLGDGVVLVTGGT
GGLGAVVARHAVVVHGVRRLVLVSRRGLGAPGAVGLVAELESLGAVVEVVACDVSDRVAL
AGVVGGIGSDLSAVVHTAGVVDDGVVGSLSVGRLSSVLGPKADAAWYLHELTVRLDLSAF
VLFSSVAGVVDGAGQGNYAAANVFLDGLAVVRRGLGLPGTSVAWGLWEGAGMGAVLGEAD
VLRMSRSGVLGLSVGEGLGLFDVALGEDVAALVPVRLDLGALRSRVDGVPAVFRSLVRVP
VRRSVGVGVSGGGEVSLERRLAVLDAGERERVLLELVRSHVAAVLGYEGAGSIEPGRAFS
DIGFDSLSAVELRNRLNGETGLRLPATLIFDYPTPQALADLIQEKTLGLVDAAAATVSTT
VSRTDDEPIAIVGMGCRYPGDVRTPEELWRLVASGTDAVSLFPEDRGWNVDSIYDPTPGL
SGKTYTREGGFLHDAAEFDAGFFGISPREALAMDPQQRLLLETSWEAMERAGIDPNSLRG
TQTGVFAGIMYHDYGSRVTQPSEEVEGYLGNGSAGSIASGRVSYTFGFEGPAVTVDTACS
SSLVALHWAAQALRQGECSMALAGGVTVMSTPETFVDFSLQRGLATNGRCKAFSSDADGT
GWGEGAGMLLLERLSDARKNGHEVLAVIRGSALNQDGASNGLTAPNGPSQQRVIRQALAN
AGLSAAEVDAVEAHGTGTKLGDPIEAQALLATYGQERDGDQPLLLGSIKSNVGHTQAAAG
VGGVIKMVMAIRNGVLPKTLHVTEPSPHVDWSAGAVELLAEAREWPETGRPRRAGVSSFG
ISGTNAHVIVEQAPTDQPAPLSEPVGDVPGLPVPWIVSAKSAEALRAQAGRLGSFLGETG
VVDVPAVGWSLVRGRSVFAHRAVVVGGEWDELLAGVARVAEGVDDSVVSGVADVSGRRVF
VFPGQGSQWVGMAQGLLDSSVVFTERMTECAAALDPLVEWSLLDVVRGVEGAASLERVDV
VQPVLWAVMVSLASVWRSVGVVPDAVVGHSQGEIAAAVVGGWLSLVDGARVVALRSLAIR
EVLAGGGGMVAVQAAEDEVAGWLEGVEGVGIAAVNGPRSVVISGTRAGLDACVELWSGRG
TWVKRVPVDYASHSAEVERVRERVLADLASVTGLSGSVPMLSTMTGDWIVEGQVGAGYWV
ENLRRPVLFADATRRLASEGFGAFVEVSAHPVLVMGIEETIEALRSGAADGAKSGAGEES
SSAVVAVGTLRRGEGGWDQFLRSLAGLFVRGAVAPDWESLLGGVRPRVDLPTYAFQRERL
WLDAGVVAGDVSGLGQVVVGHPLLGAGVGVAGEGGGVLFTGRLGLGSHPWLGDHAVSGVV
LLPGAAFVELVVRAGDEVGCGRLEELTLAAPLVVPERGSVRIQVVVGAGDGSGARSVGVW
SSVGDEGVGGEWVCHASGLLTADVGVAPVLGGVWPPVGGVAVDVSGVYEGLALEGYEYGS
VFRGLRSVWRRGDEVFAEVALGEGVGVEGFGLHPALLDAALQAAGFGSFVPESEAGSEAG
SGGVRLPFSWSGVSLFASGASVGRVRLWPVGGDGFGVELFDGVGMPVARVDALVTREISA
GQLGAAAGAGSLVGGESLFRVEWAPVSGVAPASAGVGGCVVVGAGSVLSGFGEVVPDLAA
VSAGSADGVGVPGWVLVDVDAWLGADLAVGVVSGEGVPVVARGVVARVLGLVREWLGDER
WVSSRLVWVTRGAVGARVLDEVSGVVSSGLWGLVRAAQSEHPDRFALLDLDSATAVDAVR
DGVLGLLAAGEPQLVVREGEVLAARLTPAHTTDEPTGQEFGKAATGTVLVTGGTGGLGAV
VARHLVTEHGAQRLLLTSRRGINAPGAAELVAELAELGARADVAACDVSDRAALKELLAG
VPGDAPLTAVVHAAGVLDDGVIESMTADRLDAVMRPKVDAAWHLHELTADRELDAFVLFS
SAAGTLDGAGQSNYAAANVFLDALAQYRRGQGLAGLSLAWGLWGESTGMVGALEGSDLDR
IGRSGVRALSSAEGLALFDAAAVLGEPAVLPVALDLGVLRTQPRNQVPAILRGFAAGPTR
RTAVTGGPETDQEALTRRLASLSPADRDRFLLDLVRTQVAGVLGYSGPDAIDPQRGFQEL
GVDSLAAVQIRNRLGAATGVRPPTTLVFDYPTPDAVAGYFKEHLVIEEEDSTAELMREIA
RLEAAVTSAASSAGGAGLAPAVDRLRAMAAKLADADAQRADEDDPGLESATADELFDILD
GELSTD
selected fasta
>polyketide synthase [polyketide synthase modules 1-3]
ATGAGCGAGTCCGAGAACCCCGTTTCCGCCACCACAGCCGGTGCGGATGAAACCCCGGAC
ACGCGTACGGCGCTGGCTCGGCGGCTGGCGGGACTGTCCCCCGCCGAGCAGGAGCAGCAC
CTCGTCGACATGGTGCACCGGCACACGGTCGCCGCGCTCCAGGCCGTCGCCCCGCTCACT
CCGGACCAGGTCGATGTGCAGCGCCCGTTCCTGGAACTCGGCTTCGACTCCCTCGCCGCC
GTGGACCTGCACAAGCGGCTCACCGGCGAGACCGGCCTCGAACTGCCGGTGACCGTCGCC
TTCGACTTCCCCACCCCCGTACTCGTCGCCGAGGAGATCCGCCGGATCGCCTTCGGCATC
CGGCCCGCCCCGCTCGCGCCCGTCGTCGCCACCGGCAACCTGGACGACGACCCCATCGCG
ATCATCGGCATCGGCTGCCGTTTCCCCGGCGGCATCAACTCCGCCGAGGAACTGTGGCAG
CTCGTCATGGACGAGGCCGAGGTGCTCTCCGGATTCCCCACCAACCGTGGCTGGGACGTC
GAGGGCATCTACGACCCCGACCCGGGCAAGCCCGGCAAGAGCTACGTCCGCGAAGGAGGC
TTCCTCCAGGACGCGGGCGACTTCGACGCGGACTTCTTCGGGATCTCGCCGCGCGAGGCC
CTCGCCATGGACCCGCAGCAGCGGCTCGTCCTGGAGACCGCCTGGGAGGCGTTCGAACGC
GCGGGCATCGACCCCGGCTCCCTCCACGGCAGCAAGGCCGGTGTCTTCATCGGCGCCGAG
GTCCATGAGTACGGTACGCGCGTCCATGAAGCCCCCGAAGGGCTCGACGGCTACCTCATG
ACCGGCAACGCGCCCAGCGTCGCCTCCGGCCGGATCGCCTACAGCCTCGGGCTCGAAGGC
CCCGCCGTCACCATCGACACCGCCTGCTCGGGCTCCCTCGTCGCCCTGCACCTCGCCGCG
CACTCGCTGCGCCAGGGCGAGTCCTCGCTCGCCATCGCCGGCGGTGTGACCGTCATGGGC
AACCCCGGCATGTTCGCCGCCTTCAGCCGGCAGCGCGGTCTCGCCGCCGACGGCCGCTGC
AAGCCCTTCGCCGCCGCCGCCGACGGCACCGGCTTCTCCGAGGGCGTCGGCGTCTTCGTC
GTTGAGCGCCTCGCCGACGCCCGCCGCAACGGCCACCCCGTGCTGGGCATCGTCAAGGGC
TCCGCCATCAACCAGGACGGCGCCAGCAACGGACTGACCGCCCCGAACGGCCCCTCGCAG
CAGCGCCTCATCCTCCAGGCCCTCGCCAACGCCGGTCTGAAGCCGGCGGACGTCGACACC
ATGGAGGCCCACGGCACCGGCACCAAGCTGGGTGACCCGATCGAGGCCCAGGCCATCCTG
GCGACCTACGGGCAGGAGCGCGAAGAGGGCAGGCCGCTCTGGCTCGGCTCCATCAAGTCC
AACCTCGGCCACACCCAGGCCGCGGGCGGCGCCGCCAGCCTCATCAAGATGCTGATGGGG
ATGCGCCACGGCAAGCTGCCGCGCAGCCTCCACATCGACGCGCCCACCCCGCACGTCGAC
TGGACGACCGGTGACGTCGCGCTGCTCACCGAGACCCGCGACTGGGACGCCCCCGACCGC
CCCCGGCGCGCCGGTGTCTCCGCCTTCGGCATCAGCGGCACCAACGCGCACGTGATCATC
GAGGAGGCGCCGGAGTTCGAGCCGAGCGCCGTGGAGCCGGTGGCCGGGTCGGGGGTGACA
CCGCCGTGGGTGCTGTCGGCCCGGTCGGCCGACGCGTTGCGGGGGCAGGCCGAGCGGCTG
CTGTCGTTCGTCTCCACCGACGCCGATGTCTCCGTGGTGGATGTGGCGTACTCACTCGGT
GTGTCGCGTGCGGGCCTGGAACACCGCGGTGTGGTGCTGGGGGAGTCGCGCGAGGAACTG
ATCGCGGCTCTGGAGTCGCTGGCGTCCGGTGCCGAGGCGCCGGGTGTGGTGACGGGTCGG
GTCGCCGAGGGCCGGTTGGCGTTCCTGTTCACCGGCCAGGGTGCGCAGCGCGTCGGTATG
GGCCGGGAACTCGCCGCCGAATTCCCCGTGTTCGCCGCTTCCCTGGAAGAGACCTGCGAC
CTGCTGGACGTGGGCCTGGAGGACCAGGACCACTCACTGCGCGAGGTGCTGTTCGCCGAG
GAGGGCTCGGCCGAGGCCGCCCTGCTGACGCGGACGGTGTACGCCCAGGCCGCGTTGTTC
GCGGTGGAGGTGGCGCTGTTCCGGCTGGTGGAGTCGTTCGGTGTGGTGCCGGACTTCGTC
GCCGGTCACTCGGTGGGTGAGATCGCCGCCGCACACGTCGCGGGCGTGTTCTCGCTGGAA
GACGCCACCATGCTCGTCGCCGCCCGGGGCCGGCTGATGGACGCCCTGCCGGAGGGCGGG
ACGATGGTGGCGGTGCAGGCCACCGAGGAGGATGTGCTCGCCCTGCTGGAGGGGGTGGAG
GACGCCTCCATCGCCGCGATCAACGGCCCCGACGCCGTGGTCGTCTCCGGCACCGAGACC
GGTGTCGCCCGGGTGGTCGACGTACTCCGGGACCGGGGCGCGAAGACCAAGCGGCTCGAC
GTCAGCCACGCCTTCCACTCACCGCTCATGGAGCCGATGCTCACCGAGTTCCGCCGGGTG
GCCGAGGTCCTCGAATACCAGGCACCGCGGATCGCCGTGGTGTCGAACGTGTCCGGATCG
GTCGCCGGCACCGAACTGGCCACGCCCGAGTACTGGGTCACCCACGTCCGCGAGGCCGTC
CGCTTCAGCGCCGGCGTCCGGACCCTGCTCGGCGCCGGCGTCTCCTCCTTCCTGGAGATC
GGTCCGGACGGTGTGCTCAGCGGGATGGCCCGTGGGTCGGTCTCCGACGGCGCCGACGTT
GGCTGTGTCCCCGTGATGCGCCGGGGCCGGGGTGAGGTGCGGGAGTTCCTGACCGGCCTC
TCCCGGATCGCCGTACGCGGAGTCCCGGTCACCTGGGAGCCGCTGATCGAAGGCGCCCGC
CGCGTCGAGCTGCCCACCTACGCCTTCCAGCGCCGCTGGTTCTGGCTGGAGGCCGGCCGC
TCGACCACGGACGCCCTGGGCCTGGGCCAGACCGCCGCGGAGCACCCCTTGGTGGGTGCC
GTGGTGGGTCTGGCCGGTGGTGATGGTGTCGTCCTGACCGGTCGGGTGTCGTTGCACACC
CACCCCTGGTTGGCGGATCACCAGGTCGCCGGGGTGACGCTGCTGCCGGGTACGGGCTTC
GTGGAGCTGGCGGTCCGTGCCGGTGACGAGGTCGGCTGTGGCCGGTTGGAGGAACTGACG
CTGGAGGCACCGCTCGTCGTGCCCGACCGGGGCGCCGTCCAGCTCCAGGTCGTCGTCGGC
GCACTGGAGGAGTCCGACGTCCGCACCGTCAGCGTCTACTCCCGCGCCGAGGAGGACGAC
GTCTGGACCCGCCACGCCACCGGATTCGTCGGCGCCGCCGTCGACGGCGGACTGAACCTG
GAGGCATGGCCCCCGCCGGGCGCCCGGGCGGTGGACGTCAGCGACGTCTACGCCGGACTG
GCCGACCAGGGCTACGGATACGGTCCCGTCTTCCAGGGCCTCCGGTCGGTGTGGCGCGGC
GACGGCGAGGTGTTCGCCGAGGTCGTGTTGCCGGAAGGTGCACAGGCGGACGCCTCCGCA
TTCGGGCTGCACCCCGCCCTGCTGGACGCCGCACTGCACGCCACCGACTACCTCGACCCG
GAGTCCGCCGTCGAGGGCACGCATCTGCCGTTCGCCTGGACCGGTGTCTCGCTGCACGCC
ACCGGTGCGTCCGAACTGCGGGTACGGATCACCGCCACCGGCAACGACGGATACGCGCTC
GACCTCGCCGACACCACCGGCCGCCCCGTCGCCACCGTCCAGTCGCTCGTGCTGCGCCCG
GTCACCGAGGAGCAGCTCCGCAGCGCCCAGGGCGGCAACGGCCCCGACAGCCTGTTCCGG
GTGGAATGGGCCCCCGTCACCGCCGACCTCACCGCATCCGGCGCCGGCTGGGCCGTGCTC
GGCGCCGGTGCTCCCGAACTCGCCGCCGCCCTCACCGCGGCCGGCACCCCGGGCACCGCC
TACCACGGCACGGCCGAGCTGAGCGCCGCCGTCGACGGTGGCACCACCCCCGATGTCGTC
GCCGTCCAGTTGCCGTCGGCCGGCGCCGCCGACGCCGACCTCCCGGACGCAGTCCGCGCC
ACCCTGAACACCGCGCTGGAGTTCGTCCAGAACTGGCTGGCCGACGAGCGTCTCGCCGAG
ACCAGGCTCGTGGTCGTCACCCGCGACGCCGTCACCGTCGACACCGCCGCGGGCGGCCCC
GACCTGACCGTCGCCCCCGTCTGGGGACTGATCCGCTCCGCGCAGGCCGAGAACCCCGGC
CGCATCCTGCTCGCCGACATCGACGGCACCGACCAGTCCCGTACCGCCCTGGCCGCGATC
ACCGCCGCCGACGAACCCGAACTCGCCTTCCGCAACGGCAACGCGTACGCCCCCCGGCTG
GTCAGGTCCGTCAGCGAGGGCGGCCTCGTCCCGCCGTCGGACGCCGCGAGCTGGCGCCTG
GACGTGCTGAGCCAGGGCACCCTGGAGAACCTCGCCCTCATCCCCAGCGACGCCGACGAG
CGGACCCTCGCCCCGGGCGAGGTCCGGATCGCCGTCCGTGCCGCGGGAGTCAACTTCCGT
GACGTCCTGGTGGCGCTCGGGATGTACCCGACCAAGGCGGACATCGGTGGTGAGGCCGCC
GGTCTCGTACTCGAAGTCGGCCCCGGTGTCACCGACTTCACCCCCGGCGACCGGGTGATG
GGTCTCTTCGACACCGCCTTCGGTCCGCACGCGATCACCGACCACCGCACCCTGGTGCCG
ATGCCCACCGGCTGGACCTACGCGCAGGCCGCCACGGCCCCGTTGGTCTTCGCCACCGCG
TACTACGGCCTCGTGGACCTCGCCGAACTGCGCTCCGGCGAATCGGCGCTCATCCACGCC
GCGGCCGGCGGCGTCGGCATGGCGGCCGTCCAGATCGCCCGCCACCTGGGCGCCGAGGTG
TACGGCACGGCCAGCCCCGGCAAGTGGAACGCGCTGCGCGCCGCCGGACTCGACGACAAC
CACATCGCGTCGTCCCGTGACACCACGTTCGAGCAGAAGTTCCTCGCGAACTCCGGTGGC
CGTGGCGTCGATGTCGTCCTGGACGCCCTCACCGGCGAATTCATCGACGCGTCACTCCGG
CTGCTGCCGCGCGGTGGACGCTTCGCCGAGATGGGCAAGACCGATGTGCGCGACCCGGAG
CGGGTCGCGGCCGAGTACCCCGGAGTGCGCTACCGGGCCTTCGACCTCTTCGAGGCGGAC
CTCGACCGGCTCCGCGAGATCCTGCGCGAGCTGCTCGCCCTCTTCGAGAGCGGTGCGCTG
CGGCCGCTGCCGGTGCGTGCATGGGACATCCGCAAGTCCAAGGACGCCTTCCGCCATATC
GCCCAGGCCCGGCACATCGGCAAGGTCGCCCTCACCATGCCCACGGGTGGTTTGGGTGAT
GGTGTGGTGTTGGTGACGGGTGGTACGGGTGGGTTGGGTGCGTTGGTGGCGCGGCATGTG
GTGGTGGTGCATGGGGTGCGTCGTTTGGTGTTGGTGTCGCGTCGTGGGTTGGGTGCTCCG
GGTGCGGTGGGGTTGGTGGCTGAGTTGGAGGGTTTGGGTGCTGTGGTGGAGGTGGTGGCG
TGTGATGTGAGTGATCGTGTGGCGTTGGCGGGTGTGGTGGGGGGTATTGGGTCGGATCTG
TCGGCTGTGGTGCATACGGCGGGTGTGGTGGATGACGGTGTGGTGGGTTCGTTGTCGGTG
GGGCGGTTGTCGTCGGTGTTGGGTCCGAAGGCGGATGCGGCGTGGTATTTGCATGAGTTG
ACGGTGGGGTTGGATCTGTCGGCGTTTGTGTTGTTCTCGTCGGTTGCTGGTGTGGTGGAT
GGTGCGGGTCAGGGGAATTATGCGGCGGCGAATGTGTTTTTGGATGGGTTGGCTGTGGTG
CGGCGTGGTTTGGGGTTGCCGGGTACGTCGGTGGCGTGGGGGTTGTGGGAGGGGGCTGGT
ATGGGTGCGGTGTTGGGTGAGGCTGATGTGTTGCGGATGAGTCGTTCGGGTGTGTTGGGG
TTGTCGGTGGGTGAGGGGTTGGGGTTGTTTGATGTGGCGTTGGGTGAGGATGTGGCGGCG
TTGGTGCCGGTGCGGTTGGATTTGGGGGCTTTGCGTTCGCGGGTTGATGGGGTGCCTGCG
GTGTTCCGGTCGTTGGTGCGGGTGCCGGTGCGTCGTTCGGTGGGTGTGGGTGTTTCGGGT
GGTGGTGAGGTGTCGTTGGAGCGGCGTTTGGTGGTGTTGGATGCGGGTGAGCGTGAGCGG
GTGTTGTTGGAGTTGGTGCGGTCGCATGTGGCGGCTGTGTTGGGTTATGAGGGTGCGGGG
TCGATTGAGCCGGGTCGTGCGTTCAGTGATATCGGGTTCGATTCGTTGTCGGCGGTTGAG
CTGCGGAATCGTTTGAATGGTGAGACGGGGCTGCGGCTGCCGGCGACGCTGATCTTCGAT
TACCCCACCCCTCAAGCCCTCGCCGAATACGTCATCGTCGCCCTGCTCGGCGAGGAGGCG
GCCAACGCCCCCGCCCTGCCGCCCACCGAGGCCCCCACCGTCACCGGAACCGATGACGAC
CCCGTGGTCATCGTCGGCATGGGCTGCCGCTTCCCCGGCGACGTCCGTACCCCCGAGGAC
CTGTGGCGACTGGTCTCCAACGGCAGCGACGCCGTGACCCCCTTCCCCGACAACCGCGCC
TGGGACATCGAAGGCATCTACGACCCGCTGCCCGGCGTGTCCGGGAAGACGTACGCCCGC
GAGGGCGGCTTCCTGCACGACGCGGCCGAGTTCGACCCCGAGTTCTTCGGGATCTCGCCG
CGTGAGGCCCTCGCCATGGACCCCCAGCAGCGACTGCTCCTTGAGACGTCCTGGGAGGCC
ATCGAGCGGGCGGGCATCGACCCGAACAGCCTGCGCGGAACCCAGACCGGCGTCTTCGCC
GGAGTCATGCAGACCGACTACGGCAACGGCGGCGCCCGGCTCGCCGAGGACGTCGAGGGC
TACATCGCCAACGGCACGCTCGGCAGCATCGTCTCCGGCCGGGTCTCCTACGCCCTGGGT
CTGGAGGGCCCGGCGGTCACGATCGACACCGCCTGCTCCTCCTCCCTCGTTGCCATGCAC
TGGGCGGCCCACGCCCTGCGGCAGGGCGAGTGCTCGCTCGCCCTGGCCGGCGGCGTGACC
GTCATGTCGACGCCGGAGACCTTCGTCGACTTCAGCCTTCAGCGCGGCCTCGCTCCCAAC
GGTCGGTGCAAGGCGTTCTCGGCGGACGCCGACGGCACCGGCTGGGGCGAGGGCGTCGGC
GTCCTGGTCCTTGAGCGGTTGTCGGACGCCCGCCGGAACGGGCATCAGGTACTCGCGGTC
ATCCGTGGTTCCGCGCTGAACCAGGACGGTGCGAGCAACGGCCTGACGGCTCCGAATGGT
CCCTCGCAGCAGCGGGTGATCCGCCAGGCCCTCGTGAGCGCCGGTCTGACCACGTCGGAC
GTCGACGCGGTCGAGGCGCACGGCACCGGCACCACGCTCGGTGACCCGATCGAGGCCCAG
GCGCTGCTGGCCACCTACGGCCAGGAGCGGGACGCGGACCAGCCGCTCTGGCTCGGCTCC
GTCAAGACGAACGTGGGTCACACGCAGGCCGCGGCCGGTGTTGCCGGTGTGATCAAGATG
GTGCTCGCGATGCGGGCCGGTGTGCTGCCGAAGACGCTGCATGTCACCGAGCCGTCGCCG
CACGTGGACTGGTCCGCCGGCGCCGTGGAGCTGCTGACGGAGACGCGCGACTGGCCGGAG
ACCGGCCGTCCGCGCCGCGCCGGTGTGTCGTCGTTCGGTGTGAGCGGCACGAACGCGCAC
GTCATCGTCGAGCAGGCACCCGCCGTCGAAGAGGAGCCGACGCGCGCCCTTCCGGCACTC
CCGGTCCCGTGGTCCATCTCGGCCAAGTCGGCCGACGCACTGCGCGGCCAGGCCCAGGCC
CTGTCGTCGTTCGTCTCTGCCGCCGGTGATGTGTCGGTGGTGGATGTGGCGTACTCGCTG
GGTGTGTCGCGTGCGGGTCTTGAGCATCGTGGTGTGGTGGTGGGGGAGTCGCGTGCGGAG
TTGCTCGTGGCTCTGGAGTCGTTGGCGTCCGGGGTTGAGTCGCCGGGTGTGGTGACGGGG
CGGGTCGCCGAGGGTCGGTTGGCGTTCCTGTTCACGGGGCAGGGTGCGCAGCGGGTCGGC
ATGGGTCGGGAACTCGCTGCCGAATTCCCGGTGTTCGCGGCGTCTCTTGAGCAGACGTGT
GACTTGTTGGAGCGTGCCGGGGTTGCGGTGCGTGAGGTGCTGTTCGCTGAGGAGGGTTCG
GCCGAGGCCGCCCTGCTGACGCGGACGGTGTATGCGCAGGCTGCGTTGTTCGCCGTCGAG
GTGGCGCTGTTCCGGTTGGTGGAGTCGTTCGGTGTGGTGCCGGACTTTGTCGCCGGGCAT
TCGGTGGGTGAGATCGCCGCCGCGCATGTCGCGGGCGTGTTCTCGCTTGAGGATGCGGTG
TCCCTGGTCGCGGCTCGTGGTCGGTTGATGGATGCGCTGCCGGAGGGTGGGGCGATGGTG
GCGGTGCAGGCCACCGAGGAGGATGTGCTTGCCCTGTTGGAGGGGGTGGAGGACGCCTCC
ATCGCCGCGATCAACGGCCCCGACGCCGTGGTGGTCTCCGGCACCGAGACCGGTGTCGCC
CGCGTAGTGGACGTACTCCGGGAGCGGGGTGCGAAGACCAAGCGGCTCGTGGTGAGTCAT
GCCTTCCACTCGCCGCTGATGGAGCCGATGCTCGCCGACTTCGCCACCGTCGTGGAGGGG
CTCTCGTACAAGGCTCCCGCCATCCCGGTCGTGTCGGGATCAGTTGTCGGGAGCGAGTTG
TCGACGCCGGGTTACTGGGTGCGGCATGTTCGTGAGGCGGTTCGTTTCGGTGCAGGGGTG
GAGACCCTGCTCGGCGCTGGTGTGTCGTCGTTCCTGGAGATCGGTCCGGACGGTGTGCTG
AGCGGGATGGCCCGTACGTCCGTGCCTGAGGGTGCGGATGTGGAGTGCGCGCCGCTGATG
CGCCGGGACCGCGCCGAGGTGCGGGAGTTCCTGACCGGTCTCTCCCGTCTCGCCGTACGC
GGTGTCCCGGTCGCCTGGGAGTCGCTGGTCGAAGGCGGCCGGCGGGTCGAGCTGCCGACG
TACGCCTTCCAGCGTCGCCGGTTCTGGCTGGAGGCCGGCCGTTCGGTGACGGATGCTTCG
GGTCTGGGCCAGACCGCCGCGGAGCACCCCTTGGTGGGTGCCGTGGTGGGTCTGGCCGGT
GGCGATGGTGTGGTGCTGACCGGTCGGGTGTCGTTGCACACCCACCCCTGGTTGGCGGAT
CACCAGGTCGCGGGGGTGACGCTGCTGCCGGGTACGGGCTTTGTGGAGCTGGCGGTCCGT
GCCGGTGACGAGGTCGGCTGTGGCCGGCTGGAGGAACTGACGCTGGAGGCCCCGCTGGTC
GTGCCCGACCGGGGCGCGGTGCAGCTCCAGGTCGTCGTCGGCGCACTGGAGACGTCCGGT
GTCCGTACCGTCAGCGTCTACTCCCGCGTGGAGGAAGAGAGCGCGGATGACACCTGGGTC
CGCCACGCGACCGGCGCGCTCATGGCCGCCGCCGAGGAGCCCGGATTCGACCTCACCGCA
TGGCCGCCGGCTGGTGCGCGGGCGGTCGATGTGAGTGACGCTTACGCCGGACTGGCGAGC
CAGGGCTACGGGTACGGACCCGTCTTCCAGGGGCTGACGGCCGCCTGGCGCAAGGGCCGG
GAGGTCTTCGCGGAGATCACGCTGCCGGAGGCCGCGCAGGTGGACGCTTCGGCGTTCGGG
CTGCACCCCGCGCTGCTGGACGCTGCGCTGCACGCCACCGACTACCTCGATCAGGAGAGC
GCCGAGGGCACGCATCTGCCGTTCGCGTGGAGCGGTGTCTCGCTGCACGCCGCCGGCGCG
TCCGCGCTGCGGGTACGGATCGTCGCGACCGGCAAGGACGGATACGCGCTCGACCTCGCC
GACAGCACAGGCCGCCCCGTGGCCACTGTTCAGTCGCTGGTCACCCGTCCCGTCACCGCG
GACCAACTGTCCGAAGCCTCGGCCACTCAGCACCAGTCGCTCTTCCGGATGGAGTGGACC
GCCACGACCGCCCCGGCCGCGACCGCTGATGTCCGCTGGGCGCTTCTCGGCGAGCCGGTC
GCGGAACTGGGCGACCTCGCGGGCTTCGGCCGTACGACCGCGTACGCCTCGCTCGCCGAC
CTGGCCGCCGCCGACGCGGACACCGTTCCGGACCTCGTCGTCCTGCCGCTGGGCAGCCGG
ATGGCTGAGGGAAGTGACGTACCGGAAGCGGTACGGGAGAACCTCGGTCAGGTCCTGGCG
ACGATCCAGCAGTGGAACGACGACTCCCGGTTCGACGGCTCCCGGCTCGTGGTGCTGACA
CACGGTGCCGTCTCGGTCTCCGACGATGAATCGCTCACCGCACTGGATCTGGCTCCGGTC
TGGGGTCTGGTCCGCTCGGCCATGGCCGAGACTCCCGGCCGCTTCCTGCTGGTGGACACC
GATGGGACCGACCCGTCGACCGACGCGCTGCGTCATCTGGCCGAACTCCAGGAGGCCGAG
TTCGCGCTGCGCGAGGGCGAGATACGCGTACCTCGGCTCGCGCGCGTTCCGGTGGCCGGA
GCTGGTGCCGACATCACGGGTGGTTTGGGTGATGGTGTGGTGTTGGTGACGGGTGGTACG
GGTGGGTTGGGTGCTGTGGTGGCGCGTCATGCGGTGGTGGTGCATGGGGTGCGTCGTTTG
GTGTTGGTGTCGCGTCGTGGGTTGGGTGCTCCGGGTGCGGTGGGGTTGGTGGCTGAGCTT
GAGAGCTTGGGTGCTGTGGTGGAGGTGGTGGCGTGTGATGTGAGTGATCGTGTGGCGTTG
GCTGGTGTGGTGGGGGGTATTGGGTCGGATCTGTCGGCTGTGGTGCATACGGCGGGTGTG
GTGGATGACGGTGTGGTGGGTTCGTTGTCGGTGGGGCGGTTGTCGTCGGTGTTGGGTCCG
AAGGCGGATGCGGCGTGGTATTTGCATGAGTTGACGGTGAGGTTGGATCTGTCGGCGTTT
GTGTTGTTCTCGTCGGTTGCTGGTGTGGTGGATGGTGCGGGTCAGGGGAATTATGCGGCG
GCGAATGTGTTTTTGGATGGGTTGGCTGTGGTGCGGCGTGGTTTGGGGTTGCCGGGTACG
TCGGTGGCGTGGGGGTTGTGGGAGGGGGCTGGTATGGGTGCGGTGTTGGGTGAGGCTGAT
GTGTTGCGGATGAGTCGTTCGGGTGTTTTGGGGTTGTCGGTGGGTGAGGGGTTGGGGTTG
TTTGATGTGGCGTTGGGTGAGGATGTGGCGGCGTTGGTGCCGGTGCGGTTGGATTTGGGG
GCTTTGCGTTCGCGGGTTGATGGGGTGCCTGCGGTGTTCCGGTCGTTGGTGCGGGTGCCG
GTGCGTCGTTCGGTGGGTGTGGGTGTTTCGGGTGGTGGTGAGGTGTCGTTGGAGCGGCGT
TTGGCGGTGTTGGATGCGGGTGAGCGTGAGCGGGTGTTGTTGGAGTTGGTGCGGTCGCAT
GTGGCGGCTGTGTTGGGTTATGAGGGTGCGGGGTCGATTGAGCCGGGTCGTGCGTTCAGT
GATATCGGGTTCGATTCGTTGTCGGCGGTTGAGCTGCGGAATCGTTTGAATGGTGAGACG
GGGCTGCGGCTGCCGGCGACGCTGATCTTCGATTACCCCACCCCCCAAGCCCTCGCCGAT
CTCATCCAGGAGAAGACGCTGGGTCTGGTCGACGCCGCCGCGGCCACCGTGTCCACCACG
GTGTCCCGCACCGATGACGAGCCCATCGCCATCGTCGGCATGGGCTGCCGCTACCCGGGA
GACGTCCGTACCCCCGAGGAGCTGTGGCGGCTCGTCGCCAGCGGCACGGACGCCGTCAGC
CTCTTCCCCGAGGACCGGGGCTGGAACGTCGACTCCATCTACGACCCGACGCCCGGCCTG
TCCGGGAAGACGTACACCCGTGAGGGCGGCTTCCTGCACGACGCGGCCGAGTTCGACGCC
GGCTTCTTCGGGATCTCGCCGCGCGAGGCCCTCGCCATGGACCCGCAGCAGCGACTGCTC
CTTGAGACGTCCTGGGAGGCGATGGAGCGGGCCGGCATCGACCCGAACAGCCTGCGCGGC
ACCCAGACCGGCGTCTTCGCCGGGATCATGTACCACGACTACGGGTCCCGGGTGACCCAG
CCGTCGGAGGAGGTCGAGGGCTACCTCGGCAACGGCAGCGCGGGCAGCATCGCGTCCGGC
CGGGTCTCCTACACCTTCGGGTTCGAGGGTCCGGCGGTCACGGTCGACACCGCCTGTTCC
TCCTCGCTCGTCGCCCTCCACTGGGCGGCTCAGGCCCTGCGCCAGGGCGAGTGCAGCATG
GCGCTCGCGGGCGGTGTGACCGTCATGTCGACGCCGGAGACCTTCGTCGACTTCAGCCTC
CAGCGCGGCCTTGCCACGAACGGCCGGTGCAAGGCGTTCTCGTCCGACGCGGACGGAACT
GGCTGGGGCGAGGGCGCGGGAATGCTCCTGCTGGAGCGGTTGTCGGACGCGCGGAAGAAC
GGGCACGAAGTACTCGCGGTCATCCGTGGTTCGGCGCTGAACCAGGACGGTGCGAGCAAT
GGTCTGACGGCGCCGAACGGTCCTTCGCAGCAGCGGGTGATCCGCCAGGCGCTGGCCAAC
GCCGGTCTGTCGGCCGCCGAGGTGGACGCGGTCGAGGCGCACGGTACGGGTACGAAGCTG
GGTGACCCGATCGAGGCGCAGGCGCTCCTGGCGACCTACGGCCAGGAGCGGGACGGCGAC
CAGCCGCTGCTGCTGGGCTCGATCAAGTCGAACGTCGGCCACACGCAGGCGGCCGCCGGT
GTCGGCGGTGTGATCAAGATGGTGATGGCCATCAGGAACGGTGTGCTGCCGAAGACGCTG
CATGTCACCGAGCCGTCGCCGCACGTGGATTGGTCCGCTGGTGCGGTGGAGCTGTTGGCG
GAGGCTCGGGAGTGGCCTGAGACGGGTCGTCCGCGTCGTGCGGGTGTGTCGTCGTTCGGT
ATCAGTGGGACGAATGCGCACGTGATCGTGGAGCAGGCCCCCACCGACCAGCCGGCGCCG
CTGAGCGAGCCGGTTGGTGATGTGCCGGGTCTTCCGGTGCCGTGGATCGTCTCGGCCAAG
TCCGCGGAGGCGTTGCGGGCGCAGGCGGGTCGGTTGGGTTCGTTCTTGGGTGAGACCGGT
GTTGTTGATGTGCCGGCGGTGGGTTGGTCGTTGGTGCGGGGTCGTTCGGTGTTCGCGCAT
CGGGCGGTTGTGGTGGGTGGTGAGTGGGATGAGCTGTTGGCCGGTGTGGCTCGGGTCGCT
GAGGGTGTGGATGACTCGGTTGTGTCGGGTGTGGCGGATGTGTCGGGGCGTCGGGTGTTT
GTGTTCCCGGGGCAGGGTTCGCAGTGGGTTGGTATGGCGCAGGGGTTGTTGGATTCGTCG
GTGGTGTTCACGGAGCGGATGACGGAGTGTGCTGCGGCGTTGGATCCGTTGGTGGAGTGG
TCGTTGTTGGATGTGGTGCGGGGTGTGGAGGGTGCGGCGTCGTTGGAGCGGGTGGATGTG
GTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCGTTGGCGTCGGTGTGGCGTTCGGTGGGT
GTGGTGCCGGATGCGGTGGTGGGTCATTCGCAGGGTGAGATCGCGGCTGCTGTGGTGGGT
GGTTGGTTGTCGTTGGTGGATGGTGCGCGGGTGGTGGCGTTGCGGTCGTTGGCGATTCGT
GAGGTGTTGGCGGGTGGTGGTGGCATGGTCGCGGTCCAGGCTGCCGAGGATGAGGTTGCT
GGGTGGCTTGAGGGTGTGGAGGGGGTGGGGATTGCTGCGGTGAATGGTCCGCGTTCGGTG
GTGATCTCGGGTACGCGTGCGGGTTTGGATGCGTGTGTGGAGTTGTGGTCTGGGCGGGGG
ACGTGGGTGAAGCGGGTTCCGGTGGACTATGCCTCGCATTCGGCTGAGGTGGAGCGGGTG
CGTGAGCGGGTGCTGGCGGATCTGGCGAGTGTGACGGGTTTGTCGGGGTCGGTGCCGATG
TTGTCGACGATGACGGGTGACTGGATTGTTGAGGGTCAGGTCGGGGCCGGGTATTGGGTG
GAGAATCTGCGTCGTCCGGTGTTGTTCGCGGACGCGACGAGGCGGTTGGCGTCGGAGGGC
TTCGGTGCGTTCGTCGAGGTGAGCGCGCATCCGGTCCTGGTGATGGGCATCGAGGAGACG
ATCGAGGCGCTGAGGTCGGGCGCCGCCGATGGTGCGAAGTCCGGTGCTGGTGAGGAGAGT
TCCTCCGCTGTGGTGGCGGTGGGGACGTTGCGTCGTGGTGAGGGTGGTTGGGATCAGTTC
CTGCGTTCCCTCGCGGGGCTCTTCGTCCGGGGTGCGGTGGCACCGGATTGGGAGTCGTTG
TTGGGTGGTGTGCGTCCTCGGGTTGATTTGCCGACGTATGCGTTCCAGCGTGAGCGGTTG
TGGCTGGATGCGGGTGTGGTGGCGGGGGATGTGTCGGGGTTGGGTCAGGTGGTGGTGGGT
CATCCGTTGTTGGGTGCTGGTGTGGGTGTTGCTGGTGAGGGTGGGGGTGTGTTGTTTACG
GGTCGTTTGGGGTTGGGTTCGCATCCGTGGCTGGGTGATCATGCGGTGTCGGGTGTGGTG
TTGTTGCCGGGGGCTGCGTTTGTGGAGTTGGTGGTGCGTGCGGGTGATGAGGTGGGGTGT
GGTCGGTTGGAGGAGTTGACGTTGGCGGCTCCGTTGGTGGTGCCGGAGCGTGGTTCGGTG
CGGATTCAGGTGGTGGTGGGTGCTGGTGATGGGTCGGGTGCGCGTTCGGTGGGTGTGTGG
TCGTCGGTGGGGGATGAGGGTGTGGGTGGGGAGTGGGTGTGTCATGCGTCGGGTTTGTTG
ACGGCTGATGTGGGTGTGGCGCCGGTGTTGGGTGGTGTGTGGCCGCCGGTGGGTGGTGTG
GCGGTGGATGTGTCGGGTGTGTATGAGGGGTTGGCGTTGGAGGGGTATGAGTATGGGTCG
GTGTTTCGGGGGTTGAGGTCGGTGTGGCGTCGTGGGGATGAGGTTTTTGCTGAGGTGGCG
TTGGGTGAGGGTGTGGGGGTGGAGGGGTTTGGTTTGCATCCGGCGTTGTTGGATGCGGCG
TTGCAGGCTGCTGGGTTTGGTTCGTTTGTGCCGGAGTCCGAGGCAGGGTCTGAGGCGGGT
TCGGGTGGGGTGCGGTTGCCGTTCTCGTGGTCGGGTGTGTCGTTGTTTGCGTCGGGTGCT
TCGGTGGGGCGGGTGCGGTTGTGGCCGGTGGGTGGGGATGGTTTTGGTGTGGAGTTGTTT
GATGGGGTGGGGATGCCGGTGGCGCGGGTGGATGCGTTGGTGACGCGGGAGATTAGTGCG
GGTCAGTTGGGTGCGGCTGCTGGTGCCGGGTCGTTGGTGGGTGGGGAGTCGTTGTTCCGG
GTGGAGTGGGCTCCTGTGTCGGGTGTCGCGCCGGCTTCTGCTGGTGTGGGTGGTTGTGTG
GTGGTGGGTGCGGGGAGTGTGTTGTCTGGTTTTGGGGAGGTGGTTCCGGATCTGGCGGCG
GTTTCCGCGGGTTCTGCGGATGGGGTGGGTGTGCCGGGGTGGGTGTTGGTGGATGTGGAT
GCGTGGTTGGGTGCGGATCTGGCTGTGGGTGTGGTGTCGGGTGAGGGTGTTCCGGTGGTG
GCGCGTGGTGTGGTGGCGCGGGTGTTGGGGTTGGTGCGGGAGTGGTTGGGGGATGAGCGG
TGGGTGTCGTCGCGGTTGGTGTGGGTGACGCGTGGTGCGGTGGGTGCTCGGGTGTTGGAT
GAGGTGTCGGGTGTGGTGTCGTCGGGGTTGTGGGGGTTGGTGCGGGCTGCTCAGTCGGAG
CATCCGGACCGGTTCGCGCTTCTTGATCTGGACAGTGCCACCGCCGTGGATGCCGTTCGT
GATGGTGTGTTGGGGTTGCTGGCGGCTGGTGAGCCGCAGTTGGTGGTGCGTGAGGGTGAG
GTGCTGGCCGCACGGCTGACCCCCGCCCACACCACCGATGAACCCACCGGCCAGGAGTTC
GGCAAGGCGGCGACCGGTACGGTCCTCGTCACCGGTGGCACCGGCGGCCTCGGTGCCGTC
GTCGCACGGCACCTGGTCACCGAGCACGGCGCACAGCGTCTGCTCCTCACCAGCCGTCGC
GGTATCAACGCGCCGGGAGCCGCCGAACTCGTCGCGGAACTCGCCGAGCTGGGTGCCAGG
GCCGACGTCGCAGCCTGCGACGTCTCAGACCGGGCGGCACTCAAGGAACTGCTCGCCGGC
GTACCGGGGGACGCACCGCTCACCGCGGTCGTCCACGCGGCCGGCGTGCTGGACGATGGT
GTGATCGAGTCGATGACGGCCGATCGCCTGGACGCCGTCATGCGGCCGAAGGTCGACGCG
GCCTGGCATCTGCACGAGCTGACCGCCGACCGGGAATTGGATGCGTTCGTCCTCTTCTCC
TCCGCGGCCGGCACGCTGGACGGTGCCGGACAGTCCAACTACGCGGCGGCGAATGTGTTC
CTGGACGCGCTCGCGCAGTACCGCCGTGGTCAGGGTCTGGCGGGTCTGTCGCTGGCCTGG
GGCCTGTGGGGCGAGAGCACCGGCATGGTGGGCGCGCTGGAGGGTTCGGACCTCGACCGC
ATCGGCCGCTCCGGCGTCCGGGCGCTGTCGTCGGCCGAGGGGCTCGCGCTCTTCGACGCC
GCCGCCGTGCTGGGCGAGCCGGCCGTACTGCCGGTCGCGTTGGACCTCGGCGTACTCCGG
ACACAGCCCCGGAACCAGGTTCCGGCGATCCTGCGCGGGTTCGCGGCGGGCCCGACCCGG
CGCACCGCGGTCACTGGTGGGCCCGAGACGGACCAGGAGGCGCTCACGCGGCGCCTCGCT
TCCCTCTCGCCCGCCGACCGGGACCGCTTCCTGTTGGATCTGGTCCGTACGCAGGTGGCC
GGGGTGCTCGGGTACTCCGGTCCGGACGCGATCGATCCGCAGCGCGGGTTCCAGGAGCTG
GGCGTCGACTCGCTGGCCGCCGTACAGATCCGTAACCGGCTCGGCGCGGCCACGGGTGTC
CGGCCGCCGACGACGCTCGTCTTCGACTATCCGACCCCCGACGCGGTGGCCGGGTACTTC
AAGGAGCACCTCGTCATCGAGGAGGAGGACTCGACCGCGGAGCTGATGCGGGAGATCGCC
CGGCTGGAGGCCGCGGTCACCTCCGCGGCCTCATCGGCGGGCGGCGCGGGCCTGGCACCC
GCCGTGGACCGGCTGCGGGCGATGGCGGCGAAGCTGGCCGACGCGGATGCCCAGCGGGCC
GACGAGGACGACCCGGGCCTGGAGTCCGCGACCGCGGACGAACTGTTCGACATCCTCGAC
GGTGAGCTGTCCACGGACTGA
[0] ACP41..114
[1] KS137..513
[1] AT668..989
[1] malonyl-CoA863..867
[1] DH1035..1194
[1] ER1526..1831
[1] KR1841..2019
[1] ACP2122..2192
[2] KS2220..2595
[2] AT2749..3063
[2] malonyl-CoA2940..2944
[2] DH3109..3272
[2] KR3592..3770
[2] ACP3873..3943
[3] KS3966..4342
[3] AT4499..4832
[3] methylmalonyl-CoA4690..4694
[3] DH4881..5045
[3] KR5386..5566
[3] ACP5671..5741
[0] ACP121..342
[1] KS409..1539
[1] AT2002..2967
[1] malonyl-CoA2587..2601
[1] DH3103..3582
[1] ER4576..5493
[1] KR5521..6057
[1] ACP6364..6576
[2] KS6658..7785
[2] AT8245..9189
[2] malonyl-CoA8818..8832
[2] DH9325..9816
[2] KR10774..11310
[2] ACP11617..11829
[3] KS11896..13026
[3] AT13495..14496
[3] methylmalonyl-CoA14068..14082
[3] DH14641..15135
[3] KR16156..16698
[3] ACP17011..17223

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [662-796]  G3DSA:3.40.366.10 [863-978]  G3DSA:3.40.366.10 [2743-2873]  G3DSA:3.40.366.10 [2940-3052]  G3DSA:3.40.366.10 [4494-4622]  G3DSA:3.40.366.10 [4690-4823]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1653-1674]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2150-2165]  PS00012 [3901-3916]  PS00012 [5699-5714]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [41-114]  PS50075 [2122-2192]  PS50075 [3873-3943]  PS50075 [5671-5741]  PS50075
PS50075   ACP_DOMAIN
 [52-113]  1.7e-08 PF00550 [2125-2191]  1.8e-12 PF00550 [3876-3942]  4.80000000000001e-12 PF00550 [5674-5739]  1.4e-11 PF00550
PF00550   PP-binding
 [34-153]  4.09999599045784e-20 SSF47336 [2115-2236]  2.30000440726534e-28 SSF47336 [3866-3983]  1.60000240695997e-28 SSF47336 [5664-5744]  9.00000407957274e-21 SSF47336
SSF47336   ACP_like
 [50-114]  5.00000000000001e-83 G3DSA:1.10.1200.10 [2122-2191]  5.00000000000001e-83 G3DSA:1.10.1200.10 [3873-3945]  5.00000000000001e-83 G3DSA:1.10.1200.10 [5670-5744]  5.00000000000001e-83 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1517-1662]  3.00000067992871e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1664-1755]  3.1e-15 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1545-1601]  1.1e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1841-2018]  3.60000000000002e-51 PF08659 [3592-3769]  3.40000000000004e-51 PF08659 [5386-5565]  1.9e-65 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [137-387]  1.9e-93 PF00109 [2220-2470]  1.69999999999998e-96 PF00109 [3966-4217]  1.20000000000001e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [396-513]  3.60000000000002e-44 PF02801 [2478-2595]  7.10000000000008e-48 PF02801 [4225-4342]  5.89999999999994e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [668-989]  1.99999999999999e-60 PF00698 [2749-3063]  4.10000000000004e-60 PF00698 [4499-4832]  5.00000000000001e-92 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [665-973]  5.39997012872478e-71 SSF52151 [2746-3030]  1.09999184471405e-66 SSF52151 [4497-4784]  1.40000506907309e-57 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [798-862]  2.90000354677981e-17 SSF55048 [2875-2939]  1.29999924468179e-16 SSF55048 [4625-4689]  2.90000354677981e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [139-399]  G3DSA:3.40.47.10 [400-565]  G3DSA:3.40.47.10 [2222-2482]  G3DSA:3.40.47.10 [2483-2648]  G3DSA:3.40.47.10 [3969-4229]  G3DSA:3.40.47.10 [4230-4395]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [129-565]  3.60002015031011e-99 SSF53901 [2212-2594]  6.10002656149838e-104 SSF53901 [3959-4341]  3.30001976117415e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1661-1754]  5.30000000000001e-19 G3DSA:3.40.50.720 [1838-2025]  3.19999999999996e-101 G3DSA:3.40.50.720 [3590-3776]  3.19999999999996e-101 G3DSA:3.40.50.720 [5386-5572]  3.19999999999996e-101 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [2383-2399]  PS00606 [4130-4146]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [669-970]  3.60002015031011e-115 SM00827 [2750-3044]  1.50000965748778e-109 SM00827 [4501-4814]  2.2999842048857e-105 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [42-117]  1.49999977583352e-16 SM00823 [2123-2195]  3.99998544139406e-34 SM00823 [3874-3946]  3.1999989904635e-34 SM00823 [5672-5744]  2.19999900980707e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1035-1194]  2.50000909916183e-84 SM00826 [3109-3272]  5.6999970878395e-87 SM00826 [4881-5045]  1.69998802370953e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [139-565]  SM00825 [2222-2648]  SM00825 [3969-4395]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1841-2019]  5.09998762524166e-47 SM00822 [3592-3770]  1.79999754022375e-45 SM00822 [5386-5566]  2.0000139277205e-66 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1526-1831]  SM00829
SM00829   PKS_ER
SignalP
 [1-35]  0.143 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
Vicen_00190 Vicen_00190   last last