close all open/close all
first first   Virg_00020 Virg_00020

CDS information : Virg_00010


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction7,325 / 57 / - [in whole cluster]
21,052 / 28,320 / + [in contig]
Locationcomplement(57..7325) [in whole cluster]
21052..28320 [in contig]
TypeCDS
Length7,269 bp (2,422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative nonribosomal peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in virginiamycin M biosynthesis.
Note (GenBank)
  • orf7
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative nonribosomal peptide synthetase]
MTHDPSAGVLTGTRAADGARRTSLTEEQLGLLLQHRADPAASPYNVPLALDLRGPLDPAA
LERALGTLTTRHPLLSARVVDDADGLPELEILPGRTPRLERSTVAPASDGAEAAALLAVA
RHELDLERDGVLRALLLRHGAEHHTLLLVVHHLVVDGESTAILLADLLAAYREGEVPGEA
PADFADYVADRARRADTDTTALEEYWRHRLDGADVDVDFPLDIPGRGDTPVGRSVPVELD
ADLSAEIGRFSRTHRAGPAAVLLAAYLKALGTYARQSAATVAVPLGVRNDLRFERTVGYF
VRTLLVRSPEQAGLSAAGFVARVQTELARAVDHSQLPFPKIARLVPGTDPADPQVFNCTF
VLHSWADSSAAATEGVELPGGLRARWRQDVPSPGLGLLTLELYEGEGRVRGRLKYDASRI
EAGTAEAFAEHVTTLAREIVREPERPVTDLAGIGPAARATLELLNATDHPIPDTDIDTLL
RRRTGQQPDHVAVESGDRAWTYRELDDRIDAYAQALTGRGVGAGDRVGTMLPRTDEAVAA
MLAVLRIGAAYVPVDPAHPEARRRHIVDSSGMRTVLVTADTEAACPPGPVPVRLETLTAG
PSSVPRGAPTADSALHVLYTSGSTGLPKGVQLSHRALATDVLAAIRHFGIGPDDAMLLKA
PFTFDVSAHEMLVALVAGARLVIAPPDAERDPDLLAQTLDRHRVTLLHLVPSQLRVLLEA
EDFPANRSLRTVVSTGESLPNELRRAFEAVHPARLHNAYGPTETSYSTVFSWPRGDAGSW
TGRGEVPIGVPFDNIRCHVLDDGQRLLPPGAPGELWIGGGTVSDGYLGDPDRTADRYRTL
DLGDGRPGRVYRTGDLVRLLPDGSLTHLGRFDDQVKINGNRVELGEVRAALMAVDGVEDA
TVQVARHAAGSLQITAYVVPQGLDAAAVRRDVSRALPSHMVPVRITPVTRIPLLANGKTD
RQELARLAATAEPSDAQAVEAQGAEAPAATATTVSVAAAQTSPSGAVPTAPTGAPTASAP
AAVTRPAVLPRLRAVWADLLGATEDSSQFFEDGGDSILAMQLVSRMRREGYTLTMREIYK
HPVLADLAAHLDSGVPQGPTAAAAAPAAAGPAGGRPLAPVQSWFFRHIRTDLHQWNQSVL
LELNRPLDAPALRLALQAVVAAHPALSARFEHDGATGDGRMADAAPFAAYPPREVLWERE
FGGEDELDRVLEEAEESLRPLDGIHVRAVLARDRRDGTGLLLIAVHHLVVDGVSWRILLE
DLEHALDALADGALPALPAEAWSYGQWVDDLPAVATRPGEADHWLALAEQRKAARTLLLT
TPAADEQEIRRIEFSLDAEATQQLIGPLPRRLGLSVHETMTGAFAQALARWRGTSTVTFD
VETHGRHGRDDLFRTVGWFTAIHPVVISAERARQPEEFVTEAGRELATVPQGGVGFGACR
EYEPRQAVREALRAMPPALVCFNYYGQADQLSPAGRFRMSGRPIPREHSARCERVYGIEV
YGIVHDGRLRMGLTWVPSPADGVDEVAVEALVAQMRWVLATLAGADPDAVLAGEITAPGH
AARPVRTSRTTPAGPRRESVPVTAQQHGLLLDALAHQGTGRYVEQLHWRWHGPLDTDRFT
AAWEAVFAHEAVLRTAFDWQAEPRLVLHDEGRPEVVRLAHGSDDWDDLLERDRLRGFDLR
RPGLLRATLFDEAAPGDTETASTRVLLTFHHVLLDGWSVSLLIQQFYRAYLEGGTLSETG
TRRPDFRDYSRWLHAQDTGPAREYWSAAVPAGPLAVRPALPGEPTGQQGSGRAQTRLTPA
EADRLRRWAASHAATESSALNTAWALLLSRACGSTGPVRVGFGVTVSGRGIPLDGVERLP
GLLMNSLPMTVEVDPAATVPGLLAGLRDQALDMASYEWVSTGQIHEWSGRGAGEKLVESL
LVLENYPRSQDGLENDLADQGIRVELPDAAGSETAFPVALLAYRDTDGSLVLAAVHDRSR
LADAEAATLVELCARLLRDLPVTGDDLTTVADLLETIPDDALPMMADRPVGDRADDAASW
PEGPDTQLLRDAWQAVLGTADVAPGDHFFEAGGHSLLAMKLLRKIAERTGRTLRLDDLLA
HPTAGALARLLADGPGTGEGGVLVPLREAADPDAGTVYLVHPPGGQVACYAQLAQSYPGP
EALTGIRDPRVDQAEPEHLTTEQLAGIYLEALLPVLESGRRVVLGGFSGGGVIAYEIAQR
ITADGWQPPLVVMIDAGAPDGEITDTEAEGSFASRLRAVAENRADTAAGTEAGTEADTGA
DTGADTKTDTRPHPADDPAQGRTDEPADADAYLAELAQIADWVRGDGGGDPVALMTDSVE
AVQRYRPLPYQGPVAVLRAGDTGFGRGTDYDESDRFHGRPGLGWEDHCEDLAIRIVPGNH
VTMLTGDNVRTLARILASAART
selected fasta
>non-ribosomal peptide synthetase [putative nonribosomal peptide synthetase]
ATGACCCATGACCCCTCCGCAGGCGTGCTGACCGGGACGCGGGCGGCGGACGGCGCCCGC
CGAACCTCCCTGACCGAGGAACAACTCGGCCTGCTGCTCCAGCACCGCGCCGATCCCGCC
GCATCCCCGTACAACGTGCCGCTGGCACTCGACCTGCGCGGCCCCCTCGACCCCGCCGCA
CTGGAACGGGCACTCGGCACCCTGACGACCCGCCATCCCCTGCTCTCCGCCCGCGTCGTG
GACGACGCCGACGGCCTGCCCGAGCTGGAGATCTTGCCCGGCCGCACCCCGCGTCTGGAG
CGCAGCACCGTCGCCCCCGCCTCCGACGGTGCCGAAGCCGCCGCGCTGCTGGCCGTCGCA
CGCCACGAACTGGACCTGGAACGGGACGGCGTCCTGCGGGCCCTGCTGCTGCGTCACGGC
GCCGAGCACCACACCCTGCTGCTCGTCGTCCACCACCTCGTCGTGGACGGCGAGTCCACC
GCGATCCTGCTCGCCGACCTCCTCGCCGCCTACAGGGAGGGCGAGGTCCCCGGCGAAGCC
CCGGCCGACTTCGCGGACTACGTCGCCGACCGCGCCCGGCGCGCCGACACGGACACCACC
GCCCTGGAGGAGTACTGGCGCCACCGCCTGGACGGTGCCGACGTCGACGTCGACTTCCCG
CTGGACATCCCCGGCCGCGGCGACACGCCCGTAGGCCGCAGCGTGCCCGTCGAGCTGGAC
GCCGACCTGTCCGCCGAGATCGGCCGCTTCTCCCGTACCCACCGGGCCGGCCCGGCCGCC
GTACTGCTCGCCGCCTACCTCAAGGCGCTCGGGACGTATGCGCGCCAGTCCGCCGCGACC
GTGGCCGTCCCGCTGGGCGTCCGCAACGACCTACGGTTCGAGCGCACCGTCGGCTATTTC
GTCCGGACCCTGCTCGTCCGTTCCCCCGAGCAGGCCGGCCTGAGCGCGGCCGGCTTCGTG
GCCCGCGTGCAGACCGAACTCGCCCGCGCCGTCGACCACTCCCAGCTGCCGTTCCCCAAG
ATCGCCCGCCTCGTTCCCGGCACCGACCCGGCGGACCCGCAGGTCTTCAACTGCACCTTC
GTCCTGCACAGCTGGGCCGACTCCTCCGCAGCCGCCACCGAGGGCGTCGAACTGCCCGGC
GGCCTGCGCGCCCGCTGGCGCCAGGACGTCCCCTCGCCCGGCCTCGGCCTGCTCACCCTC
GAACTGTACGAGGGCGAGGGCCGGGTCCGCGGTCGCCTCAAGTACGACGCCTCCCGCATC
GAGGCCGGCACCGCCGAGGCCTTCGCCGAGCATGTCACCACCCTCGCCCGGGAGATCGTC
CGCGAGCCCGAGCGCCCGGTCACCGACCTGGCGGGCATCGGCCCGGCCGCCCGCGCCACC
CTCGAACTGCTCAACGCCACCGACCACCCCATCCCCGACACCGACATCGACACCCTGCTG
CGCCGCCGCACCGGGCAGCAGCCCGACCACGTCGCCGTCGAGTCCGGCGACCGTGCCTGG
ACCTACCGCGAGCTCGACGACCGCATCGACGCCTACGCGCAGGCCCTCACCGGCCGCGGG
GTCGGCGCCGGCGACCGGGTCGGCACCATGCTGCCCCGCACCGACGAGGCCGTCGCCGCC
ATGCTCGCCGTACTCCGGATCGGCGCCGCGTACGTCCCGGTCGACCCGGCCCACCCCGAG
GCCCGCCGGCGCCACATCGTGGACAGCAGCGGCATGCGGACGGTACTGGTCACCGCCGAC
ACCGAGGCGGCCTGCCCGCCCGGCCCCGTACCGGTCCGCCTGGAGACGCTCACCGCCGGC
CCGTCCTCCGTGCCCCGAGGCGCCCCCACCGCCGACAGCGCCCTGCACGTCCTCTACACC
TCCGGGTCCACCGGCCTGCCCAAGGGCGTGCAGCTCAGCCACCGGGCGCTGGCCACCGAC
GTCCTCGCCGCGATCCGCCACTTCGGCATCGGCCCCGACGACGCCATGCTGCTGAAGGCG
CCGTTCACCTTCGACGTGAGCGCCCACGAGATGCTGGTCGCGCTGGTCGCCGGCGCCCGG
CTGGTCATCGCCCCACCGGACGCCGAACGCGACCCCGACCTGCTCGCCCAAACGCTCGAC
CGGCACCGGGTCACCCTGCTCCACTTGGTGCCCTCCCAGCTGCGGGTGCTGCTGGAGGCC
GAGGACTTCCCCGCCAACCGGAGCCTGCGCACCGTGGTCAGCACCGGCGAGTCGCTGCCC
AACGAACTGCGCCGCGCCTTCGAAGCGGTCCACCCCGCCCGCCTGCACAACGCGTACGGC
CCGACCGAGACCTCGTACTCGACCGTCTTCTCCTGGCCGCGCGGCGACGCGGGCTCGTGG
ACCGGCCGCGGCGAGGTGCCGATCGGCGTGCCCTTCGACAACATCCGCTGCCACGTCCTC
GACGACGGGCAGCGGCTGCTGCCGCCCGGCGCGCCGGGCGAGCTGTGGATCGGCGGGGGG
ACGGTCTCCGACGGCTACCTCGGCGATCCCGACCGGACCGCCGACCGCTACCGCACCCTC
GACCTCGGCGACGGCCGCCCCGGACGGGTCTACCGCACCGGCGACCTCGTCAGGCTGCTC
CCGGACGGATCCCTCACCCACCTCGGGCGGTTCGACGACCAGGTGAAGATCAACGGCAAC
CGGGTCGAACTCGGCGAGGTGCGCGCCGCGCTGATGGCCGTCGACGGCGTCGAGGACGCC
ACCGTCCAGGTCGCCCGGCACGCCGCGGGCAGCCTGCAGATCACCGCCTACGTGGTGCCG
CAAGGCCTGGACGCCGCAGCGGTGCGCCGGGACGTGAGCCGGGCACTGCCCTCGCACATG
GTGCCGGTGCGGATCACGCCCGTGACCCGGATTCCCCTGCTGGCCAACGGGAAGACCGAC
CGCCAGGAGCTGGCCCGGCTCGCCGCCACGGCCGAGCCGTCCGATGCGCAGGCCGTCGAA
GCACAGGGGGCCGAAGCACCGGCCGCCACCGCGACGACCGTCTCCGTCGCCGCTGCGCAG
ACCTCCCCCTCCGGTGCCGTTCCGACGGCACCCACCGGTGCCCCGACGGCGTCCGCCCCC
GCCGCGGTGACGCGGCCGGCCGTCCTGCCCAGGCTGCGCGCCGTCTGGGCCGACCTGCTG
GGAGCCACCGAGGACAGCAGCCAGTTCTTCGAGGACGGCGGTGACTCCATCCTCGCCATG
CAGCTGGTCTCCCGGATGCGGCGCGAGGGCTACACCCTGACGATGCGCGAGATCTACAAG
CACCCGGTGCTCGCCGATCTCGCCGCCCATCTCGACTCCGGCGTGCCGCAGGGCCCCACC
GCGGCGGCCGCCGCGCCTGCGGCCGCCGGCCCGGCCGGCGGACGGCCGCTCGCCCCCGTC
CAGTCGTGGTTCTTCCGCCACATCAGGACCGATCTCCACCAGTGGAACCAGTCCGTCCTG
CTGGAGCTCAACCGCCCGCTGGACGCCCCCGCGCTGCGCCTCGCCCTGCAGGCCGTCGTG
GCCGCCCACCCCGCGCTCAGCGCCCGCTTCGAGCACGACGGCGCCACCGGCGACGGCAGG
ATGGCCGACGCGGCCCCCTTCGCCGCCTACCCGCCCCGCGAGGTGTTGTGGGAGAGGGAG
TTCGGCGGTGAGGACGAGCTCGACCGGGTACTCGAAGAAGCCGAGGAGAGTCTTCGCCCC
CTGGACGGCATCCACGTGCGGGCCGTCCTCGCCCGCGACCGGCGCGACGGCACCGGTCTG
CTGCTGATCGCCGTCCACCACCTGGTCGTCGACGGGGTGTCCTGGCGCATCCTCCTGGAG
GACCTGGAACACGCCCTCGACGCCCTCGCCGACGGCGCCCTGCCCGCTCTGCCCGCCGAG
GCCTGGTCCTACGGCCAGTGGGTCGACGACCTGCCCGCCGTCGCCACCCGCCCGGGCGAG
GCCGACCACTGGCTCGCCCTGGCCGAGCAGCGCAAGGCCGCCCGTACCCTGCTGCTGACC
ACCCCGGCCGCCGACGAGCAGGAGATCCGCCGCATCGAGTTCTCCCTCGACGCCGAAGCC
ACCCAGCAGCTCATCGGCCCGCTGCCGCGCCGCCTCGGCCTGTCCGTGCACGAGACGATG
ACCGGCGCGTTCGCCCAGGCCCTCGCCCGGTGGCGCGGCACCTCCACGGTCACCTTCGAC
GTCGAGACCCACGGCCGACACGGCCGCGACGACCTGTTCCGCACCGTCGGCTGGTTCACG
GCCATCCACCCGGTGGTGATCAGTGCCGAACGCGCCCGGCAACCGGAGGAGTTCGTCACC
GAGGCCGGCCGTGAGCTGGCCACCGTACCGCAGGGCGGCGTCGGCTTCGGCGCCTGCCGC
GAGTACGAGCCCCGGCAGGCCGTGCGGGAAGCCCTGCGAGCCATGCCGCCCGCCCTGGTC
TGCTTCAACTACTACGGCCAGGCCGACCAGCTCAGCCCCGCCGGCCGGTTCCGGATGTCG
GGCCGCCCGATCCCCCGGGAGCACTCGGCGCGCTGCGAGCGCGTCTACGGCATCGAGGTC
TACGGCATCGTCCACGACGGCCGCCTGCGGATGGGACTGACCTGGGTCCCCAGCCCCGCC
GACGGCGTCGACGAGGTCGCCGTCGAGGCACTGGTCGCCCAGATGCGCTGGGTGCTCGCC
ACCCTCGCCGGCGCAGATCCCGACGCCGTCCTCGCCGGCGAGATCACGGCCCCCGGCCAC
GCCGCCCGGCCCGTCCGCACGAGCCGCACGACCCCGGCCGGACCGCGGCGCGAGAGCGTT
CCGGTCACCGCCCAACAGCACGGCCTGCTCCTCGACGCCCTGGCCCACCAGGGCACCGGC
CGCTACGTCGAACAGCTCCACTGGCGCTGGCACGGGCCCCTGGACACCGACCGCTTCACC
GCGGCCTGGGAGGCGGTCTTCGCGCACGAGGCCGTGCTGCGCACCGCCTTCGACTGGCAG
GCCGAACCACGGCTCGTCCTGCACGACGAGGGCCGGCCCGAGGTCGTCCGCCTCGCGCAC
GGCAGCGACGACTGGGACGACCTGCTCGAACGCGACCGGCTGCGCGGCTTCGACCTGCGC
CGCCCCGGCCTGCTGCGCGCCACCCTGTTCGACGAGGCCGCCCCCGGCGACACGGAAACG
GCATCCACCCGAGTCCTGCTGACCTTCCACCACGTCCTGCTGGACGGCTGGAGCGTCTCC
CTGCTGATCCAGCAGTTCTACCGCGCCTACCTGGAGGGCGGCACCCTGTCCGAAACCGGC
ACGCGCCGTCCCGACTTCCGGGACTACTCGCGCTGGCTGCACGCCCAGGACACCGGCCCG
GCCCGCGAGTACTGGTCCGCAGCCGTACCCGCGGGACCGCTCGCGGTACGCCCCGCCCTG
CCGGGCGAACCGACCGGGCAGCAGGGCTCCGGCCGCGCCCAGACCCGGCTGACGCCGGCC
GAGGCCGACCGCCTGCGCCGCTGGGCGGCATCCCACGCAGCCACCGAGAGCAGCGCGCTC
AACACCGCCTGGGCCCTGCTGCTCAGCCGCGCCTGCGGCAGCACCGGACCCGTCCGGGTC
GGCTTCGGAGTGACCGTCTCCGGACGCGGCATCCCGCTCGACGGCGTCGAACGCCTCCCC
GGCCTGCTGATGAACTCCCTGCCCATGACCGTCGAGGTCGACCCCGCGGCGACCGTCCCC
GGCCTCCTCGCCGGCCTGCGCGACCAGGCCCTGGACATGGCCTCCTACGAGTGGGTGTCC
ACCGGCCAGATCCACGAGTGGAGCGGCCGCGGAGCCGGCGAGAAGCTCGTCGAGAGCCTC
CTCGTCCTGGAGAACTACCCGCGCTCCCAGGACGGCCTGGAGAACGACCTCGCCGACCAG
GGCATCCGGGTCGAACTCCCCGACGCCGCCGGTTCGGAGACCGCCTTCCCCGTCGCCCTG
CTCGCCTACCGCGACACGGACGGCAGCCTCGTGCTGGCCGCCGTCCACGACCGGTCCCGC
CTGGCCGACGCCGAAGCCGCCACTCTGGTCGAGCTGTGCGCCCGGCTGCTGCGCGACCTC
CCGGTGACCGGCGACGACCTCACCACCGTCGCCGATCTCCTGGAGACCATCCCCGACGAC
GCCCTGCCCATGATGGCCGACCGACCCGTGGGCGACCGCGCCGACGACGCCGCCTCCTGG
CCCGAGGGCCCCGACACCCAACTCCTGCGGGACGCCTGGCAGGCCGTCCTCGGCACCGCG
GACGTCGCCCCCGGCGACCACTTCTTCGAGGCCGGCGGCCACTCGCTGCTCGCGATGAAA
CTGCTGCGCAAGATCGCCGAACGCACCGGCCGCACCCTGCGCCTGGACGATCTGCTCGCA
CACCCCACGGCCGGGGCCCTGGCCCGGCTGCTGGCCGACGGCCCGGGCACCGGCGAGGGG
GGCGTACTCGTACCGCTGCGCGAGGCCGCCGACCCGGACGCCGGAACCGTCTACCTGGTC
CACCCCCCGGGCGGGCAGGTCGCCTGCTACGCCCAGCTCGCCCAGAGCTACCCGGGCCCC
GAAGCCCTCACCGGCATCCGCGACCCGCGCGTCGACCAGGCCGAGCCGGAGCACCTGACG
ACCGAGCAACTCGCCGGAATCTACCTGGAGGCGCTGCTCCCGGTCCTGGAGAGCGGCCGG
CGGGTCGTGCTCGGCGGCTTCTCCGGAGGCGGAGTCATCGCCTACGAGATCGCCCAGCGG
ATCACCGCCGACGGCTGGCAGCCGCCCCTCGTCGTGATGATCGACGCGGGTGCCCCCGAC
GGAGAGATCACCGACACCGAGGCCGAGGGCTCGTTCGCCTCCAGGCTGCGCGCGGTCGCC
GAGAACCGCGCGGACACCGCGGCGGGCACCGAGGCGGGCACCGAGGCGGACACCGGGGCG
GACACCGGGGCGGACACCAAGACCGACACCAGGCCGCACCCCGCCGACGACCCGGCGCAG
GGCCGCACCGACGAGCCCGCCGACGCCGACGCCTACCTCGCCGAACTCGCCCAGATCGCC
GACTGGGTCCGCGGCGACGGCGGCGGCGACCCGGTCGCCCTGATGACCGACAGCGTCGAA
GCCGTCCAGCGGTACCGACCCCTGCCGTACCAGGGGCCCGTCGCGGTCCTGCGGGCCGGC
GACACCGGCTTCGGCCGCGGTACCGACTACGACGAGTCGGACCGCTTTCACGGCCGCCCG
GGCCTCGGCTGGGAAGACCACTGCGAGGACCTCGCCATCCGGATCGTGCCCGGCAACCAC
GTGACCATGCTGACCGGCGACAACGTGCGCACCCTCGCCCGCATCCTGGCGTCCGCCGCC
AGGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [501-902]  9.80000000000012e-107 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [2136-2417]  7.29999999999998e-20 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [23-309]  4.5e-44 PF00668 [1116-1408]  4.80000000000003e-46 PF00668 [1578-1874]  9.9e-43 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [2070-2085]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1031-1091]  6.40000000000001e-11 PF00550 [2048-2111]  1.1e-12 PF00550
PF00550   PP-binding
 [1019-1094]  1.70000000000001e-39 G3DSA:1.10.1200.10 [2041-2113]  1.70000000000001e-39 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1028-1092]  PS50075 [2045-2112]  PS50075
PS50075   ACP_DOMAIN
 [1021-1129]  7.79998304125571e-19 SSF47336 [2038-2113]  5.8999880940569e-17 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [501-902]  2.30000000000004e-117 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1029-1095]  1.10000029896148e-06 SM00823 [2046-2115]  4.50000034739347e-08 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [617-628]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
first first   Virg_00020 Virg_00020