close all open/close all

CDS information : Virg_00020


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction8,888 / 7,623 / - [in whole cluster]
19,489 / 20,754 / + [in contig]
Locationcomplement(7623..8888) [in whole cluster]
19489..20754 [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aminotransferase
Product (GenBank)putative phenylglycine aminotransferase
Gene
Gene (GenBank)
EC number2.6.1.-
Keyword
Note
Note (GenBank)
  • orf6
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Family/Domain
FD
IPR004839

close this sectionSequence

selected fasta
>putative aminotransferase [putative phenylglycine aminotransferase]
MSTADLHASVTDPALTSMTLLNEITGRYPQAVSFAAGRPFEGSYQVAALHRYLETYTRHL
AGQGLDPDQVTSALFQYGHTKGIINDLIARHLAVDERLTVDPASIVVTTGCQEAMVLVLR
ALRRDPQDVVFAAAPTYVGFTGAARLVEMPVRQVREGPGGLDPDDLEDQIRRARAAGLTP
RACYVIPDFANPGGAAMPVADRERLLRIAERDNILLLEDNPYSMFHDGAPRRPTLKSLDR
GARVVYFGSFAKTAFPGARIGYVIADQPVREGGVLADQLARLKSMLTLNTSSVAQAAIGG
LLLEHGCSMERASAPAADVYRRNRHALLDGLARRFGDPEHGVRWNTPAGGLFAVVTVPFR
ADDAALDDSARRFGVLWTPMHHFYAGTGGTEQLRLSFSVLTPAEIDSGLDRLAAFIADRT
H
selected fasta
>putative aminotransferase [putative phenylglycine aminotransferase]
ATGAGCACCGCCGACCTCCATGCGTCGGTGACCGATCCCGCACTGACCTCGATGACCCTG
CTCAACGAGATCACCGGCCGGTACCCGCAGGCGGTGTCGTTCGCGGCAGGCCGCCCCTTC
GAGGGCAGCTACCAGGTGGCCGCGCTCCACCGCTACCTGGAGACCTACACCCGCCACCTG
GCAGGGCAGGGCCTCGACCCCGATCAGGTGACCAGCGCGCTGTTCCAGTACGGCCACACC
AAGGGCATCATCAACGACCTGATCGCCCGCCACCTCGCGGTCGACGAGCGGCTGACGGTG
GACCCGGCCTCGATCGTGGTCACCACCGGCTGCCAGGAAGCCATGGTCCTGGTGCTGCGC
GCGCTGCGGCGCGACCCGCAGGACGTCGTGTTCGCCGCCGCCCCGACGTACGTCGGCTTC
ACCGGCGCCGCCCGGCTGGTCGAGATGCCGGTGCGGCAGGTCCGGGAGGGCCCCGGCGGC
CTTGACCCCGACGACCTGGAGGACCAGATCCGCAGGGCTCGCGCCGCCGGCCTCACACCG
CGCGCCTGCTACGTGATCCCCGACTTCGCCAACCCCGGCGGCGCCGCCATGCCGGTCGCC
GACCGGGAGCGCCTGCTGCGGATCGCCGAGCGCGACAACATCCTCCTGCTGGAGGACAAC
CCGTACTCGATGTTCCACGACGGAGCACCGCGCCGGCCCACCCTCAAGTCGCTGGACCGC
GGCGCCCGGGTGGTCTACTTCGGCTCGTTCGCCAAGACCGCCTTCCCCGGCGCCCGGATC
GGCTACGTCATCGCCGACCAGCCCGTCCGGGAGGGCGGCGTCCTCGCCGACCAGCTGGCC
AGACTCAAGAGCATGCTGACGCTCAACACCTCCTCCGTCGCGCAGGCCGCCATCGGCGGA
CTGCTGCTGGAACACGGGTGCAGCATGGAACGGGCCAGCGCACCCGCGGCGGACGTCTAC
CGGCGCAACCGGCACGCCCTGCTCGACGGCCTCGCACGCCGGTTCGGCGACCCGGAGCAC
GGCGTCCGCTGGAACACCCCGGCCGGCGGGTTGTTCGCCGTGGTCACCGTCCCCTTCCGT
GCGGACGACGCGGCCCTCGACGACTCCGCGCGCCGCTTCGGCGTGCTGTGGACGCCGATG
CACCACTTCTACGCCGGCACCGGTGGCACCGAGCAGCTGCGGCTGTCGTTCAGCGTGTTG
ACGCCGGCCGAGATCGACAGCGGCCTCGACCGGCTCGCCGCGTTCATCGCCGACCGGACC
CATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [75-412]  2.7e-31 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [71-300]  3.80000000000003e-45 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [23-419]  1.19999063421924e-69 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit