close all open/close all

CDS information : Virg_00030


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction9,193 / 8,975 / - [in whole cluster]
19,184 / 19,402 / + [in contig]
Locationcomplement(8975..9193) [in whole cluster]
19184..19402 [in contig]
TypeCDS
Length219 bp (72 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative MbtH-like protein
Product (GenBank)putative MbtH-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf5
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Related Reference
ACC
Q8GHC8
PmId
[17464055] Effects of deletions of mbtH-like genes on clorobiocin biosynthesis in Streptomyces coelicolor. (Microbiology. , 2007)
[21890635] Role of MbtH-like proteins in the adenylation of tyrosine during aminocoumarin and vancomycin biosynthesis. (J Biol Chem. , 2011)
ACC
Q50EC7
PmId
[16879412] A glutamic acid 3-methyltransferase encoded by an accessory gene locus important for daptomycin biosynthesis in Streptomyces roseosporus. (Mol Microbiol. , 2006)
ACC
Q939Y8
NITE
Balhi_00100
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[16907743] The small MbtH-like protein encoded by an internal gene of the balhimycin biosynthetic gene cluster is not required for glycopeptide production. (FEMS Microbiol Lett. , 2006)
[21826462] Function of MbtH homologs in nonribosomal peptide biosynthesis and applications in secondary metabolite discovery. (J Ind Microbiol Biotechnol. , 2011)
ACC
Q8RN06
NITE
Vanco_00110
PmId
[21890635] Role of MbtH-like proteins in the adenylation of tyrosine during aminocoumarin and vancomycin biosynthesis. (J Biol Chem. , 2011)
ACC
E2EKP2
PmId
[20964365] Activation of the pacidamycin PacL adenylation domain by MbtH-like proteins. (Biochemistry. , 2010)
ACC
A0A0A0V1G6
PmId
[27432613] Increased vancomycin production by overexpression of MbtH-like protein in Amycolatopsis orientalis KFCC10990P. (Lett Appl Microbiol. , 2016)

close this sectionSequence

selected fasta
>putative MbtH-like protein [putative MbtH-like protein]
MTNPFEDPEATYLVLVNHEGQYSLWPSFAEVPAGWTVTVQAAGRQDALDRIAGLWTDMRP
KSLVDAMNGTSA
selected fasta
>putative MbtH-like protein [putative MbtH-like protein]
ATGACCAACCCGTTCGAGGACCCCGAGGCCACCTATCTCGTACTCGTCAACCACGAGGGC
CAGTACTCGCTGTGGCCGTCGTTCGCCGAGGTTCCGGCCGGTTGGACGGTCACCGTCCAG
GCCGCCGGACGGCAGGACGCGCTCGACCGGATCGCCGGACTCTGGACCGACATGCGGCCC
AAGAGCCTGGTCGACGCCATGAACGGCACCTCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005153 MbtH-like protein (Domain)
 [1-51]  8.89999999999994e-25 PF03621
PF03621   MbtH
 [3-53]  1.10000150671642e-28 SM00923
SM00923   MbtH
IPR015166 Protein of unknown function DUF1922 (Family)
 [11-69]  1.2e-26 G3DSA:3.90.820.10
G3DSA:3.90.820.10   DUF1922
SignalP No significant hit
TMHMM No significant hit