close all open/close all

CDS information : Virg_00040


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction10,104 / 9,277 / - [in whole cluster]
18,273 / 19,100 / + [in contig]
Locationcomplement(9277..10104) [in whole cluster]
18273..19100 [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative type II thioesterase
Gene
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • orf4
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative type II thioesterase]
MSTEATATWFRCLRPRPAGRIRLLCFPHGGGSSAAFRQWHALLPDDVELHAVEYPGHADR
LLEPLVDDLARLADRACEAALPLLDRPFALYGHSLGALAAFETARRLEARGHIAVRMTAS
GMPAPHMVRPGTVHLGDDRAVLAELDRLGGVPPEVLEHPDLRELVLRTARADYRLAETYR
TAPGSVLRAPVTTHRGLQDPELTGAEAAGWRLATTAGTLHRTFPGDHFHPAADPYPVVAD
VLTGLTGPGEPAGGSTTGQPAERSPTASVSTASAR
selected fasta
>putative type II thioesterase [putative type II thioesterase]
ATGAGCACCGAGGCCACCGCCACCTGGTTCCGCTGCCTGCGCCCCCGGCCGGCCGGCCGG
ATCAGGCTGCTGTGCTTCCCGCACGGCGGCGGCTCCTCCGCCGCCTTCCGCCAGTGGCAC
GCCCTCCTGCCCGACGACGTGGAACTGCACGCGGTCGAGTACCCCGGGCACGCCGACCGC
CTCCTCGAACCACTCGTCGACGACCTCGCCCGGCTCGCCGACCGCGCCTGCGAGGCTGCA
CTGCCCCTGCTGGACCGGCCGTTCGCGCTCTACGGACACAGCCTCGGCGCCCTCGCCGCG
TTCGAGACCGCCCGCCGGCTGGAGGCCCGCGGACACATCGCGGTCCGGATGACCGCCTCC
GGGATGCCCGCACCACACATGGTGCGCCCCGGCACCGTCCACCTCGGCGACGACCGCGCC
GTACTGGCAGAACTCGACCGCCTCGGCGGAGTACCGCCCGAAGTACTCGAACACCCGGAC
CTGCGCGAGCTCGTGCTGCGCACGGCCCGTGCCGACTACCGCCTGGCCGAGACCTACCGG
ACCGCGCCCGGCTCGGTCCTGCGGGCCCCGGTGACGACCCACCGGGGCCTGCAGGACCCC
GAGCTGACCGGGGCCGAAGCGGCCGGCTGGCGGCTCGCGACCACCGCCGGAACCCTCCAC
CGGACCTTTCCCGGCGACCACTTCCACCCGGCCGCCGACCCGTACCCGGTCGTCGCCGAC
GTCCTGACCGGCCTGACCGGCCCCGGTGAGCCGGCCGGCGGCTCCACCACAGGACAACCG
GCGGAGCGCTCACCCACCGCATCCGTGTCAACGGCGTCAGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [22-231]  1.2e-47 PF00975
PF00975   Thioesterase
SignalP
 [1-34]  0.416 Signal
Bacteria, Gram-positive   
TMHMM No significant hit