close all open/close all

CDS information : Virg_00050


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction11,087 / 10,101 / - [in whole cluster]
17,290 / 18,276 / + [in contig]
Locationcomplement(10101..11087) [in whole cluster]
17290..18276 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative branched-chain alpha-keto acid dehydrogenase E1 beta subunit
Product (GenBank)putative branched-chain alpha keto acid dehydrogenase E1 subunit beta
GenebkdD
bkdB
Gene (GenBank)bkdD
EC number1.2.4.4
Keyword
Note
  • It is supposed that this ORF is not involved in both virginiamycin M and virginiamycin S biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Related Reference
ACC
Q53593
PmId
[8002616] Cloning and sequencing of a cluster of genes encoding branched-chain alpha-keto acid dehydrogenase from Streptomyces avermitilis and the production of a functional E1 [alpha beta] component in Escherichia coli. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 beta subunit [putative branched-chain alpha keto acid dehydrogenase E1 subunit beta]
MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE
SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG
GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRK
EALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLMP
LDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYPP
PLLERHYLPGVDRILDAVASLEWEAVPA
selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 beta subunit [putative branched-chain alpha keto acid dehydrogenase E1 subunit beta]
ATGTCCGAGATCACCATGGCCAAGGCGCTCAACACCGCCCTGCGCGACGCCCTGCGCGAC
GACCCCAGGACCATCCTGTTCGGCGAGGACATCGGTGCCCTCGGAGGCGTCTTCCGGATC
ACCGACGGGCTGGCCGCCGAATTCGGCGACGAACGCTGCTTCGACACCCCGCTCGCCGAA
TCGGCCATCCTGGGCACCGCCGTCGGCATGGCGATGTACGGCTACCGCCCGGTCGTCGAA
ATGCAGTTCGACGCCTTCGCCTACCCCGCCTTCGAACAGCTCGTCAGCCACGTCGCCAAA
CTGCGCAACCGCACGCGCGGCGCCATCGGCCTCCCCTTGACCATCCGCATCCCGTACGGC
GGCGGCATCGGCGGCGTCGAGCACCACAGCGACTCCTCCGAGATCTACTACATGGCCACC
CCCGGACTGACGGTCGTCACCCCGGCGACCGCGGCCGACGCGTACTCGCTGCTGCGTCGT
TCCATAGCCTCCCCCGACCCCGTGGTCTTCCTCGAACCCAAGCGGCTGTACTGGCGCAAG
GAGGCCCTCGGACTGCCGGTGGACACCGGCCCGCTCGGCTCGGCGGTCATAAGACGGCAC
GGCACCCATGCCACCCTCATCGCCTACGGCCCCGCGGTCACCACCGCGCTGGAAGCCGCC
GAGGCCGCAGCCGAGCACGGCTGGGACCTCGAAGTCATCGACCTGCGGACCCTGATGCCG
CTCGACGACGCGACGGTCTGCGCCAGCGTGCGCCGTACCGGACGCGCCGTCGTCGTCCAC
GAGGCGCACGGCTTCGCCGGCCCGGGCGCCGAGATCGCCGCCCGGATCACCGAACGCTGC
TTCTACCACCTGGAAGCACCCGTGCGCCGCGTCACCGGATTCGACGTGCCGTACCCGCCG
CCGCTGCTGGAGCGCCACTACCTGCCCGGCGTGGACCGGATCCTGGACGCGGTGGCGTCC
CTGGAATGGGAGGCGGTCCCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005475 Transketolase-like, pyrimidine-binding domain (Domain)
 [3-177]  4.10000000000004e-44 PF02779
PF02779   Transket_pyr
 [4-179]  6.59996953923913e-70 SM00861
SM00861   Transket_pyr
IPR005476 Transketolase, C-terminal (Domain)
 [193-311]  7.29999999999998e-37 PF02780
PF02780   Transketolase_C
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [193-321]  1e-36 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [197-318]  1.29999999999998e-42 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
SignalP No significant hit
TMHMM No significant hit