close all open/close all

CDS information : Virg_00060


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction12,190 / 11,087 / - [in whole cluster]
16,187 / 17,290 / + [in contig]
Locationcomplement(11087..12190) [in whole cluster]
16187..17290 [in contig]
TypeCDS
Length1,104 bp (367 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative branched-chain alpha-keto acid dehydrogenase E1 alpha subunit
Product (GenBank)putative branched-chain alpha keto acid dehydrogenase E1 subunit alpha
GenebkdC
bkdA
Gene (GenBank)bkdC
EC number1.2.4.4
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Related Reference
ACC
Q53592
PmId
[8002616] Cloning and sequencing of a cluster of genes encoding branched-chain alpha-keto acid dehydrogenase from Streptomyces avermitilis and the production of a functional E1 [alpha beta] component in Escherichia coli. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 alpha subunit [putative branched-chain alpha keto acid dehydrogenase E1 subunit alpha]
MTVLEAATAAPAPAGPVTAGPVTAAPAAAAPAAAGVPPDRQLLMYRAMVVGRAFNRQATA
FSRQGRLAVYPSSRGQEACQVGSALAVRPTDWLFPTYRESVALLTRGIDPVQVLTLFRGD
QHCGYDPVTEHTAPQCTPLATQCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEAL
NYAAVRRAPVVFLVQNNQYAISVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAV
HDAAERARAGHGPTLIEAVTYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAA
GVLDRAAADGIAAAADAFAGELSARFSAPPTGDPMQMFRHVYHHLPPHLREQSERLAAEL
AADGQGD
selected fasta
>putative branched-chain alpha-keto acid dehydrogenase E1 alpha subunit [putative branched-chain alpha keto acid dehydrogenase E1 subunit alpha]
GTGACCGTACTCGAAGCGGCCACCGCCGCCCCGGCCCCTGCCGGTCCGGTCACCGCCGGT
CCGGTCACCGCCGCCCCGGCCGCCGCCGCCCCGGCCGCCGCCGGGGTGCCGCCCGACCGG
CAGCTGCTCATGTACCGGGCCATGGTGGTCGGCCGCGCCTTCAACCGGCAGGCCACCGCC
TTCAGCCGGCAGGGGCGGCTCGCCGTCTACCCCTCCTCCCGCGGCCAAGAAGCCTGCCAA
GTGGGCTCGGCGCTCGCCGTCCGCCCCACCGACTGGCTGTTCCCCACCTACCGGGAGAGC
GTCGCACTGCTCACCCGAGGGATCGACCCGGTGCAGGTGCTCACCCTCTTCCGGGGCGAC
CAGCACTGCGGATACGACCCGGTGACCGAGCACACCGCCCCCCAGTGCACCCCGCTGGCG
ACCCAGTGCCTGCACGCCGCAGGGCTGGCCGACGCCGCCCGCATGGCAGGCGACCCGATC
GTGGCGCTCGCCTACATCGGCGACGGCGCCACCAGCGAGGGCGACTTCCACGAGGCGCTC
AACTACGCCGCCGTCCGCCGCGCCCCCGTCGTCTTCCTGGTCCAGAACAACCAGTACGCG
ATCAGCGTCCCGCTCGCCAAGCAGACCGCGGCCCGCACCCTGGCCGACAAGGCCGCCGGC
TACGGCATGCCCGGAGTGCGGATCGACGGCAACGACGTTCTCCAGGTGTACCGGGCCGTC
CACGACGCCGCCGAACGGGCCCGGGCCGGCCACGGGCCGACCCTGATCGAGGCGGTCACC
TACCGGATCGACGCGCACACCAACGCCGACGACGACACCCGCTACCGCCCCGCCGGGGAG
GCCGACGTCTGGGCCGCCCAGGATCCGGTCGACCGCCTCGAACGGGACCTGCTGGCCGCC
GGGGTGCTCGACCGCGCCGCCGCCGACGGGATCGCCGCGGCCGCCGACGCCTTCGCCGGC
GAACTGAGCGCTCGCTTCTCGGCGCCGCCGACGGGGGACCCGATGCAGATGTTCCGGCAC
GTGTACCACCACCTACCGCCCCACCTGCGCGAGCAGTCGGAGCGGCTGGCAGCCGAACTG
GCCGCGGACGGACAGGGGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001017 Dehydrogenase, E1 component (Domain)
 [45-311]  4.09999999999995e-79 PF00676
PF00676   E1_dh
SignalP
 [1-24]  0.99 Signal
Bacteria, Gram-negative   
 [1-29]  0.998 Signal
Bacteria, Gram-positive   
 [1-34]  0.928 Signal
Eukaryota   
TMHMM No significant hit