close all open/close all

CDS information : Virg_00070


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction13,581 / 12,187 / - [in whole cluster]
14,796 / 16,190 / + [in contig]
Locationcomplement(12187..13581) [in whole cluster]
14796..16190 [in contig]
TypeCDS
Length1,395 bp (464 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxygenase
Product (GenBank)phenylacetyl-CoA dioxygenase
Gene
Gene (GenBank)visG
EC number
Keyword
  • virginiamycin S
  • L-phenylglycine
Note
Note (GenBank)
Reference
ACC
PmId
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)
Related Reference
ACC
Q8KLK7
NITE
A4793_00200
PmId
[18004875] Substrate recognition and catalysis by the cofactor-independent dioxygenase DpgC. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>putative oxygenase [phenylacetyl-CoA dioxygenase]
MPSTLIAGAVPGTTSPHTPDVADTTLTGDFATDRDTATGLLRTLTARITELPTRGERTEH
QQRTADTLHRGARTLRRDFLARHAEQVYTELTDGHTRHLRLDRLAELAADRYPGLVPGRD
LLAADGRLAQRDKEGWEIDLGIFFHAVLDSPRAGSHLLCTMLRPTPDALAALPEYRRTGR
ADLKLATVTRRDGIAHLELCNDAYLNAEDDAAVAALETGTDLVLLDEASRVGVLRGAPMS
HSAYRGRRVFSAGINLTHLYHGEISLLGFFLRREIGYIAKFTRGLCLDGEAGGERWWPQA
DKPWVGAVDSFAIGGGMQILPTLDRVVAADDSWFSLPAMEEGLVPGVANLRLTALTGSRP
ARRIVLWGHRLRAGDPDAALLVDETAPADAMDAAVERAAQHLDNPAVAANRRMMTLGEEP
LDLFRRYMAAYALEQSYRLYSPDLIANLERTWISRRARSGGGLR
selected fasta
>putative oxygenase [phenylacetyl-CoA dioxygenase]
TTGCCTTCCACCCTCATCGCCGGCGCGGTGCCCGGCACCACTTCCCCGCACACCCCGGAC
GTGGCCGACACCACCCTGACCGGCGACTTCGCCACCGACCGCGACACAGCCACCGGCCTG
CTGCGCACGCTCACCGCCCGCATCACCGAACTGCCGACCCGGGGCGAGCGGACCGAGCAC
CAGCAGCGCACCGCCGACACCCTCCACCGGGGCGCCCGCACCCTGCGCCGGGACTTCCTC
GCCCGCCACGCGGAGCAGGTCTACACCGAGCTGACGGACGGCCACACCCGCCACCTCCGC
CTGGACCGGCTCGCCGAACTGGCTGCCGACCGCTACCCGGGGCTGGTGCCCGGCCGCGAC
CTGCTGGCCGCCGACGGCCGGCTCGCCCAGCGCGACAAGGAAGGCTGGGAAATCGACCTC
GGCATCTTCTTCCACGCCGTCCTCGACTCCCCGCGGGCCGGCTCCCACCTGCTGTGCACC
ATGCTGCGGCCCACCCCCGACGCCCTGGCCGCGCTCCCCGAGTACCGCCGCACCGGCCGG
GCCGACCTGAAGCTCGCCACCGTCACCCGCCGCGACGGCATCGCCCACCTAGAGCTGTGC
AACGACGCCTACCTCAACGCCGAGGACGACGCGGCCGTCGCCGCCCTGGAGACCGGCACC
GACCTGGTGCTGCTCGACGAGGCGAGCCGGGTCGGAGTCCTGCGCGGCGCTCCCATGTCG
CACTCCGCCTACCGCGGCCGACGGGTGTTCAGCGCCGGCATCAACCTCACCCACCTCTAC
CACGGCGAGATCTCCCTCCTCGGCTTCTTCCTGCGCCGCGAGATCGGCTACATCGCGAAG
TTCACCCGCGGCCTGTGCCTGGACGGCGAGGCGGGCGGTGAGCGCTGGTGGCCACAGGCG
GACAAGCCGTGGGTGGGCGCCGTCGATTCCTTCGCGATCGGCGGCGGCATGCAGATCCTG
CCCACCCTCGACCGGGTGGTGGCCGCCGACGACTCGTGGTTCAGCCTGCCCGCCATGGAG
GAGGGGCTCGTCCCCGGCGTCGCCAACCTGCGACTCACCGCACTGACAGGCAGCCGGCCC
GCCCGCCGGATCGTCCTGTGGGGCCACCGGCTGCGCGCCGGTGACCCGGACGCGGCACTG
CTCGTCGACGAGACCGCCCCGGCCGACGCCATGGACGCCGCCGTCGAGCGGGCCGCCCAG
CACCTCGACAACCCCGCCGTCGCCGCCAACCGCCGCATGATGACCCTCGGTGAGGAGCCG
CTGGACCTCTTCCGCCGCTACATGGCCGCCTACGCCCTCGAACAGTCCTACCGGCTGTAC
AGCCCGGACCTCATAGCCAACCTGGAGCGGACCTGGATCAGTCGCCGCGCCCGCAGCGGA
GGTGGCCTGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [300-408]  5e-12 PF00378
PF00378   ECH
SignalP
 [1-16]  0.51 Signal
Eukaryota   
TMHMM No significant hit