close all open/close all

CDS information : Virg_00080


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction28,376 / 13,614 / - [in whole cluster]
1 / 14,763 / + [in contig]
Locationcomplement(13614..28376) [in whole cluster]
1..14763 [in contig]
TypeCDS
Length14,763 bp (4,920 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)nonribosomal peptide synthetase for virginiamycin S
Gene
Gene (GenBank)visF
EC number
Keyword
  • virginiamycin S
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[21816878] VisG is essential for biosynthesis of virginiamycin S, a streptogramin type B antibiotic, as a provider of the nonproteinogenic amino acid phenylglycine. (Microbiology. , 2011)

close this sectionPKS/NRPS Module

S3 proline
4 phenylalanine
5 L-pipecolate
6 L-phenylglycine
C8..307
A491..884
PCP966..1033
C1049..1349
A1541..1931
MT2030..2129
PCP2440..2507
C2523..2823
A3015..3431
PCP3513..3580
C3597..3897
A4091..4495
PCP4579..4646
TE4668..4899

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [nonribosomal peptide synthetase for virginiamycin S]
MIQNGLADFLPLSPLQEGLLFQVQYDPDGVDVYNVQMVLELRGPLDTDSLRAAVQGLLRR
HPNLRAGFWQQDMDQPVQFVPHHVDPEWQELDLTALDPAAREEALARFVAEDRARRFDPA
RPPLLRLGLAALGPNHHTLVLTTHHLLMDGWSMPLMVRELFQLYERGGDDRGMPAAPPYR
TYLAWLAGRDQDAAREAWRGYLAGLEAPTLVGRSGRTGRDTTAPSELPGQLWYELDAPAS
AALAAAARSRGLTLNTVVQGAWAVLVGHLLGRDDVVLGATMANRPPEIPGIDSTIGMFIN
TLPVRVALRPAEPFADLLARVQREQASLIDHRHMSLAEIQRTAGHGELFDSAVVFENYPL
DPTVLRAESRGLRLADFQVGDATHFALTLLAIPGERIRFRLDHRADALDAAGARTLLERL
ERLLTGFAADPDRPVGRLGLLSDAEHHQVVEGWNATGRAVSDRTLPELFEEQAARTPRAT
ALTFEGRTVDYADLNARANRLARRLAARGAGPERTVALRLPRSVDLYVAVLAVLKTGAAY
LPIDPEYPSDRIAAMLEDARPALVLTEDDVDEDLSGIPDGNLTDAERTAPLTPAHPAYVI
YTSGSTGRPKAVVMPGAAVVNLLAWHRREIPAGAGTTVAQFASLSFDVAAQEILSTLLYG
ATLAVPTDAVRRDADAFAAWLEEYRVNELYAPNLVVEALAEAAAEQGRTLPDLRHIAQAG
EALTAGPRVRDFCAALPGRRLHNHYGPAETHVMTGIELPVDPGGWPERVPIGGPVDNARL
YVLDGFLRPVPPGVVGELYLAGAGVARGYLNRPGLTAERFVADPFGGPGTRMYRTGDLAR
WAGSGVLEFAGRADHQVKVRGFRIEPVEVESVLAAQPGVARAVVLAREDRPGERRLVAYL
VAVPGSVPDPGVLREALGRVLPAFMVPSSFVVLDALPLTPNGKLDRAALPAPGRSVEGRG
VPRTPQQEILASLFAEVLGLSKVGIHEDFFDLGGHSLLATRLTSRIRTVLGAEIAVRDLF
EAPTVEALAETLEEAREVRPALRAADRPEHVPLSFAQRRLWFLDRLEGPNSTYNIPLALR
LRGELDRPALQQALTDLTHRHESLRTVYPSADGRPYQHVLAPHEAEPGLVVVPADEAGLA
EMLAEAARHEFDVTSEPPLRVSLFTLAPDEHVLLLLLHHIAGDGWSLAPLTRDLTRAYTA
RRDGAAPDWEPLPVQYADYTLWQQEMLGSPDDPDSLGARQLDHWARSLAGAPEQLELPTD
HNRPAAAGHHGRTVPFHLEPELHERLSALARSCDASLFMVLHAAFAALLTKHGAGTDIPI
GSPIAGRTDEALDDLVGFFVNTLVLRTDTSGDPTFRELVARTRATDLAAYAHQDLPFEKL
VETLNPQRSLARNPLFQVLLAFQSMPTAQPVLPGLDVVHEPVRVGFAKFDLALAVAEERH
ADGRRSLRGDWEFSTDLFEQATVEALGARLTALLASVAADPDQPIGRVGILDPAERHRIL
HTWNDTSRPGADATWPELFQARAAEHPDAVALVQEGTETGYADLNTRANRLARLLRAQGI
GPEQVVALSLPRSADLIVSVLAVLKTGAAYLPVDPAYPAERIAYLLQDGAPALVLTHTSV
AAGLPGGVPQLLVDQVGLDDVPGHDLTDAERTTPLHPLHPAYVIYTSGSTGLPKGVPVPH
RSVASVLVPLIEEFGLGPGSRVLQFASISFDAALWEITLALLSGATLVVAPAEQLQPGPA
LAELVARTGTTFLTLPPTALAVLADDALPAGVDLVVAGEATSPDQVGRWSTGRRMTNAYG
PTEAAVCTTISAPLTGAVVPPIGRPVPNARAYVLDALLQPVPPGVVGELYLAGGGLARGY
RNRPGLTAERFVADPFGTPGARMYRTGDLARWRPDGELEFAGRTDHQVKIRGFRIEPGEV
EAALATHPAVERAAVIAARHEDDRRLVAYLVPAGAGTPADGRDRGREQSQLDSWQETYDE
HYGELTGTFGDDFDGWNSSYTNTAIPAAEMADWRNASVDRIRALRPSRILEIGCGSGLIL
APLAGECEAYWGTDISPAVVARLRGQVDRLPGLAGKVELRARPAHVLDGLPRGFFDTIVL
NSVVQYFPNADYLADVLTGVLDLLAPGGSVYIGDVRNHRLLETFRTAVELRRAGAFADDG
AVRRAVAQSTADEPELLLDPDFFTVFAAAAPAVTGVGLEVRRGRHHNEMSRHRYDVVLRT
AVPAAVPAAVPAGVEETLDWDADLTGPDALATLLEQRRPARLRVTAVPNLRLAQENRARL
ALQDDGAALALARLDEPAPAGLPDCEDFHALGERLGYRTAVTWSDGRDGALDVVFTLPEL
PELPELPETGGDVAPYRSTAPAGTPLATLANDPGRAHSGGELAAEVRAHAERILPAHMVP
AAFVVLDDLPLTPNGKLDRAALPAPDWDADAAGQAPRNQREEILSTLFAEVLGLPKVGID
RDFFALGGHSLLATRLLSRIRAVLGTELAVRDLFEAPTVAALATLLGNAQGVRPPLRPME
RTGPLPLSFAQNRLWFLHRLEGPGATYNIPMSLRLTGELDAAALAEALADVTARHETLRT
LYPETDGVPHQMVLPPGGARPALRTVDTTAADADALMAAEAGIGFDLATELPLRATLYRL
APDEHVLLLVLHHIAGDGWSWRPLARDLSTAYAARVEGRAPDQAPLPVHYADYTLWQRDL
LGDEHDPDSRYARQLEHWTGALAQLPEMLELPLDHPRPAVISYRGDHVPFTVPTALHRRL
LALAADTRASLFMVLQAAFAELLTKHGAGTDIPIGSPIAGRTDEALDDLVGFFVNTLVLR
TDTSGDPTFRELVERVREGDLAAYAHQDLPFEKLVERLRPERSLARHPLFQVMLAFLSDG
EAQLDLPGLRATPAPVGVGIAKFDLHLSMVEHRSADGGPAEIQAALEFSTDLFERSTAEA
VTRRLLHLLEQVTADPDRPLSGIDILDPAERQRLLTDWNTTNGAQNDECIPAMLERQVAH
TPDGVALVHEGDRLTYAELNARANRLARRLVARGAGPEQIVALALPRSVDLVVALLAVLK
TGAAYLPVDTEYPAARITQMLGDAAPVCIVTVPGACDGLPEGLDRLDPSDSTGPSDGHTF
GGEPAESDLTDAERTAPLTPAHPAYVIYTSGSTGRPKAVVMPHAGLANLLTWHSARFPGG
PGVRTAQYTAIGFDFSVQEILSPLVMGKTLVVPTDAVRRDADALAAWLEEYRVNELFAPN
LVVEALAEAAAEQGRTLPDLTDIFQGGEALTAGEQVRELYRTLPGRRLHNVYGPAETHAV
TTHTLPVDPGGWPERVPIGGPVDNARLYVLDGFLRPVPPGVVGELYLAGAGVARGYLNRP
GLTAERFVADPFGGPGTRMYRTGDLARWAGSGVLEFAGRADHQVKVRGFRIEPGEVESVL
AAQPGVARAVVLAREDRPGERRLVAYLVAVPGSVPDPGVLREALGRVLPAFMVPSSFVVL
DALPLTPNGKLDRAALPAPGRSVEGRGVPRTPQQEILASLFAEVLGLSKVGIHEDFFDLG
GHSLLATRLTSRIRTVLGAEIAVRDLFEAPTVEALADVLQRGDRGRRPAPRATDRPEHVP
LSFGQNRLWFLNRLGGPDPSYNLPVAVRLTGPLDEAALGAALADVTARHESLRTVFPDHD
GTPWQRVLTGDDARPALAVRATTEQDLPGDLAAAARHGFDLTRELPLRVTLFTLAPDEHV
LLLLLHHIAGDGWSLAPLGRDLTRAYRARLDGGAPDWEALPVQYADYTLWQRELLGDEDA
PDNLLHRQRDHWKQTLAGLPEQLDLPADRPRPAVAGNQGEAILRTLPADLHRDLLALARQ
NGASLFMVLQAGLAALLTRVGAGTDIPIGTPVAGRTDDALDDLVGLFINTLVLRTDTSGD
PTFRDLIGRARKTALAAYAHQDLPFERLVEAVRPERSLAHHPLFQVLLALQNTPEGGLSL
PGVSVRAEMVDLGAAKFDLTFNLVERHAEDGTPGGIDAMLEYRTDLFDPATAEALADRLV
RLLAHAAAAPDRPIGLLPILDDAEHERAVTGWNATAHRPARSAATLTGLFAEQAARTPDA
VAVATGSEQLTYRELDTRANRLAHRLIAEGVRPETPVAVLQERSADLVVSTLAVLKAGGV
YVPLHTGHPAERMRQVIAQTCAPLLLTDRASLDRLPDPGTRGLVVDAQTADAAGVWPGHD
PGVAAAPDRLAYVMFTSGSTGVPKGIGITHGDAVDLALDRCWEPGPDARVLMHSPYAFDI
STYELWSPLLSGGRIVVAPPGNLDAAVLRRVVADEGVTSLLLTAGLFGVVADEAPDAFAG
VPQVWTGGDVVPPTAVRRVLQHCPGTVVKVLYGPTETTLGCTWHAFTDAGRVPDLVPIGR
PLDNTRAYVLDARLQPVPPGVPGELYIAGAGLARGYWGEPGRTAERFVADPFADRFDDTG
SRMYRTGDLARHTADGVIEFLGRSDDQVKIRGFRIEPGEVESALALDPEVARAAVVARAD
RSGSTALVAYVLPADPAAAPDPVRLRADLEARLPDYMVPSAFVVLDTLPLTPNGKLDRDA
LPAPQWAGPGTGRLPRDPREELLCGLFAEVLGLERVGIDDGFFELGGHSMLATRLMGRIN
TVLGTELTVRTLFEAPTVAALAARTDGPQTTADPLGVILPLRAEGTRPPLFCLHPAGGFG
WIYSGLLRHLDRDQPVYAVQARGLAQDEPLPPTLDEMAQDYAEQIRKTAPNGPYQLLGWS
FGGLLAHAVASRLEAGGAEVTLLAVLDGYPGSYGSGEHQVGEQEVMAILLNAAQVDRTVL
GDGSLSRPEVMSLLRESGSALAGLDEDTVTRMVAVFLNNTRLLEGFVPGHFGGDLEFFAA
TRDRTDPTLTADLWQPHIGGLIDEHRLDTDHAGLARADALAVIGRTLAARTPRPEAATPR
selected fasta
>non-ribosomal peptide synthetase [nonribosomal peptide synthetase for virginiamycin S]
ATGATCCAGAACGGCCTCGCCGACTTCCTGCCGTTGTCGCCGCTTCAGGAGGGGCTCCTG
TTCCAGGTCCAGTACGACCCGGACGGAGTGGACGTCTACAACGTCCAGATGGTCCTCGAA
CTGCGCGGCCCGCTCGACACGGACAGCCTGCGGGCCGCCGTCCAGGGCTTGCTGCGCCGC
CACCCCAACCTGCGGGCCGGCTTCTGGCAGCAGGACATGGACCAGCCCGTCCAGTTCGTG
CCGCACCACGTCGACCCCGAATGGCAGGAGCTCGACCTCACCGCCCTCGACCCGGCCGCC
CGCGAGGAGGCGCTCGCCCGGTTCGTCGCCGAGGACCGCGCCCGTCGCTTCGACCCCGCC
CGGCCGCCGCTGCTGCGCCTGGGCCTGGCCGCGCTCGGCCCCAACCACCACACCCTCGTG
CTGACCACCCACCACCTCCTGATGGACGGCTGGTCGATGCCGCTGATGGTGCGCGAGCTG
TTCCAGCTGTACGAACGCGGCGGCGACGACCGCGGCATGCCCGCCGCACCCCCGTACCGC
ACCTACCTGGCCTGGCTGGCCGGACGTGACCAGGACGCCGCCCGCGAGGCGTGGCGCGGC
TACCTGGCGGGCCTGGAAGCCCCGACCCTGGTCGGCCGGTCCGGCCGGACCGGCAGGGAC
ACCACCGCCCCCTCGGAGCTGCCCGGCCAGCTCTGGTACGAGCTGGACGCCCCCGCGTCG
GCCGCGCTGGCCGCCGCCGCCCGCTCCCGCGGCCTGACCCTGAACACGGTCGTGCAGGGC
GCCTGGGCGGTTCTGGTCGGCCACCTGCTGGGCCGCGACGACGTGGTCCTCGGCGCGACC
ATGGCCAACCGCCCGCCGGAGATCCCCGGCATCGATTCCACCATCGGCATGTTCATCAAC
ACCCTGCCGGTCCGCGTGGCACTGCGCCCCGCCGAGCCGTTCGCCGACCTGCTCGCCCGG
GTCCAGCGCGAACAGGCCTCGCTCATCGACCACCGGCACATGTCGCTCGCCGAGATCCAG
CGGACCGCCGGCCACGGCGAACTCTTCGACTCCGCAGTCGTGTTCGAGAACTATCCGCTG
GACCCGACCGTCCTGCGCGCCGAGAGCCGCGGCCTGCGGCTGGCCGACTTCCAGGTCGGC
GACGCCACCCACTTCGCCCTGACCCTGCTCGCCATCCCGGGCGAGCGGATCCGCTTCCGC
CTCGACCACCGCGCCGACGCGCTGGACGCCGCCGGCGCCCGCACCCTGCTGGAGCGGCTG
GAGCGGCTCCTCACCGGCTTCGCCGCCGACCCCGACCGCCCGGTGGGCAGGCTCGGACTG
CTCTCCGACGCCGAACACCACCAGGTCGTCGAAGGCTGGAACGCGACCGGCCGCGCCGTG
TCCGACCGCACCCTGCCCGAGCTGTTCGAGGAGCAGGCCGCCCGGACCCCGCGGGCCACT
GCCCTCACCTTCGAGGGCCGCACCGTCGACTACGCCGACCTGAACGCCCGCGCCAACCGG
CTCGCCCGCCGGCTGGCCGCCCGCGGCGCCGGACCGGAGCGGACCGTCGCGCTGCGCCTG
CCCCGCTCCGTCGACCTGTACGTCGCCGTGCTGGCCGTGCTCAAGACCGGTGCCGCCTAC
CTGCCCATCGACCCCGAGTACCCGTCCGACCGGATCGCCGCCATGCTGGAGGACGCCCGT
CCGGCCCTGGTCCTCACCGAGGACGACGTCGACGAAGACCTCTCCGGCATCCCCGACGGG
AACCTGACCGACGCCGAGCGCACGGCGCCGCTGACCCCGGCCCACCCGGCGTACGTCATC
TACACCTCCGGCTCCACCGGCCGCCCCAAGGCCGTCGTCATGCCCGGCGCCGCAGTCGTC
AACCTGCTCGCCTGGCACCGCCGGGAGATCCCCGCAGGCGCCGGCACCACCGTCGCGCAG
TTCGCCTCGCTCAGCTTCGACGTGGCCGCCCAGGAGATCCTCTCCACCCTGCTGTACGGC
GCCACCCTCGCCGTCCCCACCGACGCGGTGCGCCGGGACGCCGACGCGTTCGCCGCGTGG
CTGGAGGAGTACCGGGTCAACGAGCTGTACGCGCCCAACCTGGTCGTCGAGGCGCTCGCC
GAGGCCGCCGCCGAACAGGGCCGTACCCTGCCCGACCTGCGGCACATCGCCCAGGCCGGC
GAGGCGCTCACCGCCGGCCCGCGCGTCCGCGACTTCTGCGCGGCCCTGCCCGGCCGGCGC
CTGCACAACCACTACGGCCCCGCCGAGACCCACGTGATGACCGGCATCGAACTCCCGGTC
GATCCGGGTGGGTGGCCGGAGCGGGTGCCGATCGGTGGTCCGGTGGACAATGCGCGGCTG
TACGTGTTGGACGGGTTCTTGCGTCCGGTGCCGCCGGGTGTGGTGGGTGAGTTGTATCTC
GCGGGTGCGGGTGTGGCTCGTGGTTATCTGAATCGTCCGGGGCTGACGGCGGAGCGTTTC
GTCGCCGATCCGTTCGGTGGGCCGGGGACGCGTATGTACCGCACGGGTGATCTGGCGCGG
TGGGCCGGGTCGGGTGTGCTGGAGTTCGCGGGCCGTGCGGATCATCAGGTGAAGGTCCGG
GGTTTCCGGATCGAGCCGGTTGAGGTGGAGAGTGTGCTGGCGGCGCAGCCGGGGGTGGCC
CGGGCTGTGGTGTTGGCGCGGGAGGACCGGCCGGGGGAGCGGCGGCTGGTGGCCTATCTG
GTTGCGGTGCCGGGTTCGGTGCCGGATCCGGGTGTGTTGCGTGAGGCTCTGGGTCGGGTG
TTGCCGGCTTTCATGGTGCCGTCGTCGTTCGTGGTGTTGGATGCGTTGCCGTTGACGCCG
AACGGGAAGCTGGACCGGGCGGCGCTGCCGGCGCCGGGCCGGTCGGTGGAGGGCCGCGGT
GTGCCGCGCACGCCGCAGCAGGAGATTCTGGCGTCGTTGTTCGCGGAGGTGCTGGGGCTG
TCGAAGGTCGGCATCCACGAGGACTTCTTCGACCTGGGTGGGCACTCGTTGCTCGCGACC
CGGCTGACCAGCCGGATCCGTACCGTCCTGGGTGCCGAGATCGCGGTCCGTGACCTGTTC
GAGGCACCCACCGTCGAGGCCCTCGCCGAAACCCTGGAAGAGGCCCGCGAGGTCCGCCCC
GCCCTGCGCGCCGCCGACCGCCCCGAACACGTCCCGCTGTCCTTCGCCCAGCGGCGCCTG
TGGTTCCTCGACCGCCTGGAAGGACCCAACTCCACCTACAACATCCCGCTCGCCCTGCGC
CTGCGCGGCGAGCTGGACCGACCGGCGCTGCAACAGGCCCTCACCGACCTGACGCACCGC
CACGAAAGCCTGCGCACCGTCTACCCGAGCGCCGACGGCCGGCCCTACCAGCACGTCCTC
GCACCGCACGAGGCCGAGCCCGGCCTCGTCGTCGTCCCCGCCGACGAGGCCGGACTCGCC
GAGATGCTGGCCGAGGCCGCCCGCCACGAGTTCGACGTCACCTCCGAACCGCCGCTGCGG
GTCTCCCTGTTCACCCTCGCACCGGACGAGCACGTCCTGCTCCTGCTGCTGCACCACATC
GCCGGCGACGGCTGGTCGCTCGCACCACTCACCCGCGACCTCACCCGCGCCTACACCGCC
CGCCGGGACGGCGCCGCCCCCGACTGGGAGCCCCTCCCGGTCCAGTACGCCGACTACACC
CTCTGGCAGCAGGAGATGCTCGGCTCGCCGGACGACCCCGACAGCCTCGGCGCCCGCCAG
CTCGACCACTGGGCCCGGTCCCTGGCCGGCGCCCCCGAGCAACTGGAACTGCCCACCGAC
CACAACCGGCCGGCCGCCGCCGGCCACCACGGCCGCACCGTCCCCTTCCACCTGGAGCCC
GAGCTGCACGAGCGGCTCAGCGCCCTGGCCAGGTCCTGCGACGCCAGCCTGTTCATGGTC
CTGCACGCCGCGTTCGCCGCGCTGCTCACCAAGCACGGTGCCGGCACCGACATCCCGATC
GGCAGCCCCATCGCCGGCCGCACCGACGAGGCCCTCGACGATCTGGTCGGGTTCTTCGTC
AACACCCTGGTCCTGCGCACCGACACCTCCGGCGATCCGACCTTCCGCGAACTCGTGGCA
CGCACCCGCGCCACCGACCTGGCCGCATACGCACACCAGGACCTGCCCTTCGAGAAGCTC
GTCGAGACTCTCAACCCGCAGCGCTCGCTCGCCCGCAACCCGCTGTTCCAGGTACTGCTG
GCCTTCCAGAGCATGCCCACGGCACAGCCCGTGCTGCCCGGCCTCGACGTCGTCCACGAG
CCGGTCCGCGTCGGATTCGCCAAGTTCGACCTGGCCCTGGCCGTGGCCGAGGAACGGCAC
GCCGACGGCCGCCGGTCGCTGCGCGGCGACTGGGAGTTCAGCACCGACCTGTTCGAGCAG
GCCACCGTGGAGGCCCTCGGGGCCAGGCTCACCGCCCTGCTGGCGTCGGTCGCCGCCGAC
CCCGACCAGCCGATCGGACGGGTGGGCATCCTCGACCCGGCCGAACGCCACCGCATCCTC
CACACCTGGAACGACACCTCCCGCCCCGGCGCGGACGCCACCTGGCCGGAGCTGTTCCAG
GCCCGCGCCGCCGAGCACCCCGACGCCGTCGCCCTGGTCCAGGAGGGCACCGAGACCGGC
TACGCCGACCTGAACACCCGGGCCAACCGGCTCGCCCGGCTGCTCCGCGCACAGGGCATC
GGCCCGGAGCAGGTGGTGGCCCTGTCGCTGCCCCGCTCCGCAGACCTGATCGTCTCCGTC
CTCGCCGTGCTGAAGACCGGCGCCGCCTACCTGCCGGTCGATCCCGCCTACCCGGCCGAG
CGGATTGCGTACCTGCTCCAGGACGGCGCCCCCGCGCTCGTCCTCACCCACACCTCCGTC
GCGGCCGGCCTGCCCGGCGGCGTACCGCAGCTGCTGGTCGACCAGGTCGGCCTCGACGAT
GTCCCCGGCCACGACCTCACCGACGCCGAGCGCACCACGCCCCTGCACCCGCTGCACCCC
GCCTACGTCATCTACACCTCCGGCTCCACCGGCCTGCCCAAGGGCGTGCCCGTCCCGCAC
CGCAGCGTGGCGTCCGTTCTCGTCCCCCTGATCGAGGAGTTCGGCCTCGGCCCCGGCAGC
AGGGTCCTGCAGTTCGCCTCGATCAGCTTCGACGCCGCCCTGTGGGAGATCACCCTCGCC
CTGCTGTCCGGCGCCACCCTCGTGGTCGCACCCGCCGAGCAGCTTCAGCCCGGCCCCGCG
CTGGCCGAGCTCGTCGCCCGGACCGGCACCACCTTCCTCACCCTCCCGCCCACCGCCCTC
GCGGTCCTCGCCGACGATGCCCTGCCGGCCGGCGTGGACCTCGTCGTCGCCGGCGAGGCG
ACCTCCCCCGACCAGGTCGGACGCTGGTCCACCGGCCGCCGGATGACGAACGCCTACGGG
CCCACCGAGGCCGCGGTCTGCACCACCATCAGCGCCCCCCTCACCGGCGCCGTCGTACCG
CCGATCGGCCGGCCCGTCCCCAACGCCCGCGCGTACGTTCTCGACGCGCTGCTCCAGCCG
GTACCGCCCGGAGTGGTCGGTGAGCTGTACCTGGCCGGCGGCGGCCTGGCCCGCGGCTAC
CGCAACCGGCCCGGCCTGACAGCGGAGCGGTTCGTCGCCGACCCGTTCGGTACGCCCGGC
GCGCGCATGTACCGCACCGGCGACCTGGCGCGGTGGCGCCCCGACGGCGAGCTGGAGTTC
GCCGGCCGCACCGACCACCAGGTGAAGATCCGCGGCTTCCGGATCGAGCCCGGCGAAGTC
GAGGCCGCGCTCGCCACCCACCCGGCGGTCGAACGCGCCGCCGTCATCGCCGCCCGGCAC
GAGGACGACCGTCGCCTGGTCGCCTACCTGGTACCCGCCGGGGCCGGCACGCCGGCCGAC
GGCCGCGACCGGGGCCGCGAGCAGAGCCAGCTCGACAGCTGGCAGGAGACCTACGACGAG
CACTACGGTGAGCTGACGGGCACCTTCGGCGACGACTTCGACGGCTGGAACAGCAGTTAC
ACCAACACGGCCATCCCCGCCGCGGAGATGGCCGACTGGCGCAACGCCAGCGTGGACCGC
ATCCGCGCCCTGCGCCCGAGCCGGATCCTGGAGATCGGCTGCGGCTCGGGCCTGATCCTC
GCGCCACTGGCCGGCGAGTGCGAGGCGTACTGGGGCACCGACATCTCCCCGGCCGTGGTG
GCCCGCCTGCGCGGGCAGGTCGACCGCTTGCCCGGGCTCGCCGGGAAGGTCGAACTGCGA
GCCCGGCCCGCACACGTACTCGACGGCCTGCCCCGCGGGTTCTTCGACACCATCGTGCTC
AACTCCGTCGTGCAGTACTTCCCCAACGCCGACTACTTGGCGGACGTTCTCACCGGCGTC
CTGGACCTCCTCGCCCCCGGCGGCTCGGTCTACATCGGCGACGTCCGCAACCACCGGCTG
CTGGAGACCTTCCGCACCGCCGTCGAACTGCGCAGGGCCGGCGCCTTCGCCGACGACGGC
GCCGTCCGCCGGGCCGTCGCCCAGAGCACCGCCGACGAGCCGGAGCTGCTGCTCGACCCC
GACTTCTTCACGGTGTTCGCCGCGGCCGCGCCCGCGGTCACGGGCGTCGGCCTGGAGGTC
CGCCGCGGCCGCCACCACAATGAGATGAGCCGCCACCGCTACGACGTGGTGCTCCGCACC
GCCGTCCCCGCCGCCGTCCCCGCCGCCGTCCCCGCCGGCGTGGAGGAGACGCTCGACTGG
GACGCCGACCTCACCGGCCCGGACGCCCTCGCCACGCTCCTGGAGCAGCGCCGGCCCGCG
CGCCTGCGCGTCACCGCCGTCCCCAACCTTCGCCTCGCCCAGGAGAACCGGGCCCGCCTG
GCACTCCAGGACGATGGCGCAGCCCTCGCCCTCGCCCGGCTGGACGAGCCGGCTCCCGCC
GGCCTCCCGGACTGCGAGGACTTCCACGCCCTCGGCGAACGGCTCGGCTACCGCACCGCC
GTCACCTGGTCCGACGGCCGCGACGGAGCCCTCGACGTGGTGTTCACACTGCCGGAACTG
CCGGAACTGCCGGAACTGCCGGAGACGGGAGGGGACGTCGCACCCTACCGCTCGACCGCC
CCGGCCGGCACCCCGCTCGCCACCCTGGCGAACGACCCCGGCCGCGCCCACAGCGGCGGC
GAACTGGCCGCCGAGGTACGGGCCCACGCCGAGCGGATCCTCCCCGCCCACATGGTCCCC
GCCGCATTCGTCGTCCTCGACGACCTGCCGCTCACCCCCAACGGCAAGCTCGACCGCGCC
GCGCTGCCCGCCCCCGACTGGGACGCCGACGCCGCCGGCCAGGCCCCGCGCAACCAGCGC
GAGGAGATCCTCAGCACCCTGTTCGCCGAGGTCCTCGGCCTGCCCAAGGTCGGCATCGAC
CGGGACTTCTTCGCACTCGGCGGCCACTCGCTCCTCGCCACCCGGCTGCTCAGCCGGATC
CGCGCCGTCCTCGGCACCGAACTGGCCGTACGCGACCTCTTCGAGGCGCCGACCGTCGCC
GCCCTCGCCACCCTGCTCGGCAACGCCCAGGGCGTCCGCCCGCCGCTGCGCCCCATGGAA
CGGACCGGCCCGCTGCCGCTGTCCTTCGCCCAGAACCGGCTGTGGTTCCTGCACCGCCTG
GAAGGCCCGGGAGCGACCTACAACATACCGATGAGCCTGCGGCTGACCGGCGAACTCGAC
GCCGCCGCGCTGGCCGAGGCGCTCGCCGACGTGACCGCCCGCCACGAGACCCTGCGCACC
CTCTACCCGGAGACCGACGGAGTACCGCACCAGATGGTCCTCCCGCCCGGCGGGGCCCGC
CCCGCCCTGCGCACGGTGGACACCACCGCGGCCGACGCGGACGCGCTGATGGCTGCCGAG
GCCGGCATCGGCTTCGACCTCGCCACCGAACTCCCGCTGCGTGCCACGCTGTACCGGCTG
GCACCGGACGAGCACGTCCTGCTGCTGGTGCTGCACCACATCGCCGGCGACGGCTGGTCG
TGGCGGCCCCTCGCCCGCGACCTGTCCACGGCCTACGCGGCCCGCGTCGAGGGTCGCGCC
CCGGACCAGGCGCCGCTGCCCGTCCACTACGCGGACTACACCCTGTGGCAGCGCGACCTG
CTCGGCGACGAACACGACCCCGACAGCCGGTACGCCCGCCAGCTCGAACACTGGACCGGC
GCACTGGCCCAGCTGCCGGAGATGCTGGAACTCCCGCTGGACCACCCCCGCCCGGCCGTC
ATCAGCTACCGCGGCGACCACGTCCCGTTCACCGTGCCCACCGCACTGCACCGGCGGCTG
CTCGCCCTCGCCGCCGACACTCGCGCCAGCCTCTTCATGGTGCTCCAGGCCGCCTTCGCC
GAGCTGCTCACCAAGCACGGTGCCGGCACCGACATCCCGATCGGCAGCCCCATCGCCGGC
CGCACCGACGAGGCCCTCGACGATCTGGTCGGGTTCTTCGTCAACACCCTGGTCCTGCGC
ACCGACACCTCCGGCGACCCGACCTTCCGCGAACTCGTCGAACGGGTCCGGGAGGGCGAC
CTGGCCGCCTACGCACACCAGGACCTGCCCTTCGAGAAGCTCGTCGAACGGCTCCGCCCG
GAGCGCTCCCTCGCCCGCCACCCGCTGTTCCAGGTCATGCTGGCCTTCCTCAGCGACGGC
GAGGCACAGCTCGACCTGCCCGGACTGCGTGCGACGCCGGCACCGGTCGGCGTCGGCATC
GCCAAGTTCGACCTGCACCTGAGCATGGTCGAGCACCGCAGCGCCGACGGCGGCCCCGCC
GAGATCCAGGCAGCCCTCGAATTCAGCACCGACCTCTTCGAGCGGTCCACCGCCGAGGCC
GTCACCCGGCGCCTGCTGCACCTGCTGGAGCAGGTCACCGCCGACCCGGACCGCCCGCTG
AGCGGCATCGACATCCTCGACCCGGCCGAGCGGCAACGCCTGCTGACGGACTGGAACACG
ACGAACGGAGCGCAGAACGATGAGTGCATACCGGCGATGCTTGAGCGCCAGGTGGCGCAT
ACGCCGGATGGTGTGGCACTGGTGCACGAGGGCGATCGGCTGACCTACGCCGAGCTGAAC
GCCCGCGCCAACCGCCTGGCCCGCCGCCTGGTCGCCCGCGGCGCCGGACCGGAGCAGATC
GTCGCCCTGGCCCTGCCCCGCTCCGTCGACCTCGTCGTCGCGCTGCTCGCCGTTCTCAAG
ACCGGCGCCGCCTACCTGCCCGTGGACACCGAATACCCTGCCGCGCGGATCACCCAGATG
CTGGGCGACGCGGCACCGGTGTGCATCGTCACCGTGCCCGGAGCCTGCGACGGACTGCCT
GAGGGGCTCGACCGCCTCGACCCGTCCGACAGCACCGGACCGTCCGACGGCCACACCTTC
GGCGGTGAACCCGCCGAGAGCGACCTGACCGACGCCGAGCGGACGGCGCCGCTGACCCCG
GCCCACCCGGCGTACGTCATCTACACCTCCGGCTCCACCGGCCGCCCCAAGGCCGTCGTC
ATGCCCCACGCGGGCCTGGCCAACCTGCTGACCTGGCACTCCGCACGCTTCCCGGGCGGC
CCGGGCGTGCGCACCGCCCAGTACACCGCCATCGGCTTCGACTTCTCCGTCCAGGAGATC
CTCTCGCCGCTGGTCATGGGCAAGACCCTGGTCGTCCCGACGGACGCCGTGCGGCGCGAC
GCCGACGCGCTCGCCGCGTGGCTGGAGGAGTACCGGGTCAACGAGCTGTTCGCACCCAAC
CTGGTCGTCGAGGCGCTCGCCGAGGCCGCCGCCGAACAGGGCCGTACCCTGCCCGACCTC
ACCGACATCTTCCAAGGCGGCGAGGCCCTCACCGCCGGCGAACAGGTTCGAGAGCTGTAC
CGGACGCTCCCCGGCCGACGCCTGCACAACGTCTACGGCCCGGCCGAGACCCACGCTGTC
ACCACCCACACCCTCCCGGTCGATCCGGGTGGGTGGCCGGAGCGGGTGCCGATCGGTGGT
CCGGTGGACAATGCGCGGCTGTACGTGTTGGACGGGTTCTTGCGTCCGGTGCCGCCGGGT
GTGGTGGGTGAGTTGTATCTCGCGGGTGCGGGTGTGGCTCGTGGTTATCTGAATCGTCCG
GGGCTGACGGCGGAGCGTTTCGTCGCCGATCCGTTCGGTGGGCCGGGGACGCGTATGTAC
CGCACGGGTGATCTGGCGCGGTGGGCCGGGTCGGGTGTGCTGGAGTTCGCGGGCCGTGCG
GATCATCAGGTGAAGGTCCGGGGTTTCCGGATCGAGCCGGGTGAGGTGGAGAGTGTGCTG
GCGGCGCAGCCGGGGGTGGCCCGGGCTGTGGTGTTGGCGCGGGAGGACCGGCCGGGGGAG
CGGCGGCTGGTGGCCTATCTGGTTGCGGTGCCGGGTTCGGTGCCGGATCCGGGTGTGTTG
CGTGAGGCTCTGGGTCGGGTGTTGCCGGCTTTCATGGTGCCGTCGTCGTTCGTGGTGTTG
GATGCGTTGCCGTTGACGCCGAACGGGAAGCTGGACCGGGCGGCGCTGCCGGCGCCGGGC
CGGTCGGTGGAGGGCCGCGGTGTGCCGCGCACGCCGCAGCAGGAGATTCTGGCGTCGTTG
TTCGCGGAGGTGCTGGGGCTGTCGAAGGTCGGCATCCACGAGGACTTCTTCGACCTGGGT
GGGCACTCGTTGCTCGCGACCCGGCTGACCAGCCGGATCCGTACCGTCCTGGGTGCCGAG
ATCGCGGTCCGTGACCTGTTCGAGGCACCCACCGTCGAGGCCCTCGCCGATGTCCTTCAG
CGGGGCGACCGTGGCCGGCGGCCCGCTCCCCGCGCCACCGACCGCCCCGAACACGTCCCG
CTGTCCTTCGGACAGAACCGGCTGTGGTTCCTCAACCGGCTCGGCGGCCCCGACCCCAGC
TACAACCTCCCGGTTGCGGTCCGCCTCACCGGCCCGCTCGACGAGGCCGCCCTCGGCGCC
GCCCTCGCCGACGTCACCGCCCGGCACGAGAGCCTGCGTACCGTCTTCCCCGACCACGAC
GGCACGCCCTGGCAGCGGGTCCTCACCGGGGACGACGCCCGCCCCGCCCTCGCGGTACGG
GCCACCACCGAGCAGGACCTCCCCGGCGACCTCGCCGCGGCGGCACGGCACGGCTTCGAC
CTCACCCGTGAACTGCCGCTGCGCGTGACCCTGTTCACCCTCGCACCGGACGAGCACGTC
CTGCTCCTGCTGCTGCACCACATCGCCGGCGACGGCTGGTCGCTCGCACCGCTGGGCCGC
GACCTGACCCGCGCCTACCGGGCCCGGCTCGACGGCGGCGCACCCGACTGGGAGGCCCTC
CCGGTCCAGTACGCCGACTACACCCTGTGGCAGCGCGAACTGCTCGGCGACGAGGACGCC
CCGGACAACCTGCTGCACCGCCAGCGCGACCACTGGAAGCAGACCCTGGCCGGGCTGCCG
GAACAGCTCGATCTGCCCGCCGACCGGCCCCGCCCGGCCGTCGCCGGCAACCAGGGCGAA
GCCATCCTGCGGACCCTCCCCGCCGATCTCCACCGGGACCTGCTGGCCCTGGCCCGGCAG
AACGGCGCGAGCCTCTTCATGGTGCTCCAAGCCGGCCTCGCCGCCCTGCTCACCCGGGTC
GGCGCCGGCACCGACATCCCGATCGGCACCCCGGTCGCGGGACGCACCGACGACGCGCTC
GACGACCTCGTCGGACTGTTCATCAACACCCTGGTCCTGCGCACCGACACCTCCGGCGAC
CCGACCTTCCGCGATCTGATCGGCCGCGCCCGAAAGACGGCCCTGGCCGCCTACGCCCAC
CAGGACCTGCCCTTCGAACGGCTCGTGGAGGCCGTCCGCCCGGAGCGGTCGCTCGCCCAC
CACCCCCTGTTCCAGGTCCTCCTCGCGCTCCAGAACACCCCGGAGGGCGGCCTGTCGCTC
CCCGGCGTGAGCGTCCGCGCCGAGATGGTCGACCTCGGCGCCGCCAAGTTCGACCTCACC
TTCAACCTGGTCGAACGGCACGCCGAGGACGGCACCCCCGGCGGCATCGACGCCATGCTG
GAGTACCGCACCGACCTGTTCGACCCGGCCACCGCCGAGGCGCTCGCCGACCGCCTGGTA
CGGCTGCTGGCGCACGCCGCCGCCGCACCGGACCGGCCGATCGGCCTCCTGCCGATCCTC
GACGACGCCGAGCACGAGCGCGCGGTGACCGGCTGGAACGCCACCGCCCACCGGCCGGCC
CGCTCTGCGGCGACCCTGACCGGCCTCTTCGCCGAGCAGGCCGCCCGCACCCCGGACGCC
GTCGCTGTGGCAACGGGCTCCGAGCAGCTGACGTACCGCGAACTCGACACCCGGGCCAAC
CGGCTCGCGCACCGGCTGATCGCCGAGGGCGTCCGCCCGGAAACACCGGTGGCCGTCCTC
CAGGAACGCTCCGCCGACCTGGTGGTCTCCACCCTCGCGGTGCTCAAGGCCGGCGGCGTC
TACGTCCCCCTGCACACCGGACACCCTGCCGAGCGGATGCGCCAGGTGATCGCCCAGACC
TGCGCCCCCCTGCTGCTCACCGACCGCGCCTCGCTGGACCGCCTGCCCGACCCGGGCACC
CGCGGCCTGGTCGTCGACGCGCAGACCGCGGACGCCGCCGGCGTCTGGCCCGGCCACGAC
CCCGGCGTCGCCGCCGCACCCGACCGGCTCGCCTACGTGATGTTCACCTCCGGTTCCACC
GGCGTCCCCAAGGGCATCGGCATCACCCACGGCGACGCCGTCGACCTCGCCCTGGACCGC
TGCTGGGAGCCCGGCCCCGACGCGCGGGTTCTGATGCACTCCCCGTACGCCTTCGACATC
TCCACCTATGAACTGTGGAGCCCGCTGCTGTCCGGCGGCCGGATCGTCGTCGCCCCGCCC
GGCAACCTGGACGCGGCCGTGCTGCGCCGGGTCGTGGCCGACGAGGGCGTCACCTCCCTC
CTCCTGACGGCCGGCCTCTTCGGGGTCGTCGCCGACGAGGCGCCGGACGCCTTCGCCGGA
GTCCCCCAGGTGTGGACCGGCGGCGACGTCGTACCGCCGACCGCCGTGCGACGCGTCCTG
CAGCACTGCCCGGGCACCGTGGTCAAGGTGCTCTACGGCCCGACCGAGACCACCCTCGGC
TGCACCTGGCACGCGTTCACCGACGCCGGCCGGGTCCCGGACCTCGTGCCGATCGGCCGC
CCGCTGGACAACACCCGCGCCTACGTCCTGGATGCCCGGCTCCAGCCCGTCCCCCCCGGA
GTCCCCGGCGAGCTGTACATCGCCGGCGCCGGCCTCGCCCGCGGCTACTGGGGAGAGCCC
GGACGCACCGCGGAGCGCTTCGTCGCCGACCCGTTCGCCGACCGCTTCGACGACACGGGC
TCCCGGATGTACCGCACCGGCGACCTGGCCCGCCACACCGCCGACGGCGTCATCGAGTTC
CTCGGCCGCTCCGACGACCAGGTGAAGATCCGCGGCTTCCGGATCGAACCCGGCGAGGTG
GAGAGCGCCCTCGCGCTGGACCCGGAAGTCGCCCGGGCCGCCGTTGTCGCCCGCGCCGAC
CGCTCCGGCAGCACCGCCCTGGTGGCGTACGTCCTGCCGGCCGACCCCGCCGCCGCACCC
GACCCGGTCCGGCTCCGCGCCGACCTGGAGGCCAGGCTGCCCGACTACATGGTCCCCTCC
GCGTTCGTGGTGCTGGACACCCTCCCGCTGACCCCCAACGGGAAGCTCGACCGGGACGCC
CTGCCCGCACCGCAGTGGGCCGGCCCCGGCACCGGGCGGCTGCCCCGCGACCCCCGCGAG
GAACTGCTCTGCGGCCTCTTCGCGGAGGTGCTCGGCCTCGAACGGGTCGGCATCGACGAC
GGCTTCTTCGAACTGGGCGGCCACTCCATGCTGGCGACCAGGCTGATGGGCCGTATCAAC
ACCGTCCTCGGCACCGAGCTGACCGTACGCACCCTCTTCGAGGCCCCGACCGTGGCGGCG
CTCGCCGCCCGCACCGACGGCCCGCAGACCACGGCCGACCCGCTGGGCGTCATCCTCCCC
CTGCGGGCCGAGGGCACCCGGCCGCCGCTGTTCTGCCTGCACCCCGCCGGCGGATTCGGC
TGGATCTACTCCGGCCTGCTGCGCCACCTCGACCGCGACCAGCCCGTGTACGCCGTCCAG
GCCAGGGGACTCGCCCAGGACGAACCGCTTCCGCCGACCCTGGACGAGATGGCGCAGGAC
TACGCGGAACAGATCCGCAAGACCGCCCCGAACGGCCCCTACCAGCTGCTCGGTTGGTCC
TTCGGCGGACTCCTCGCCCACGCCGTCGCGTCGCGGCTGGAAGCCGGGGGCGCCGAGGTG
ACCCTGCTCGCCGTCCTCGACGGCTACCCCGGCTCCTACGGCTCCGGCGAGCACCAGGTG
GGCGAACAGGAGGTCATGGCGATCCTGCTGAACGCCGCCCAGGTCGACCGGACCGTACTC
GGCGACGGCTCCCTCAGCCGCCCGGAGGTCATGTCCCTGCTGCGCGAGTCCGGCAGCGCC
CTGGCCGGCCTGGACGAGGACACCGTCACCCGCATGGTCGCCGTCTTCCTCAACAACACC
CGCCTCCTGGAGGGCTTCGTTCCCGGCCACTTCGGCGGCGACCTGGAGTTCTTCGCGGCC
ACCCGCGACCGCACCGACCCGACCCTGACGGCCGACCTGTGGCAGCCGCACATCGGCGGC
CTCATCGACGAGCACCGCCTGGACACCGACCACGCCGGACTCGCCCGGGCCGACGCCCTC
GCCGTGATCGGCCGCACCCTGGCCGCCCGGACGCCCCGGCCGGAGGCCGCGACGCCCCGA
TGA
[3] C8..307
[3] A491..884
[3] proline647..753
[3] PCP966..1033
[4] C1049..1349
[4] A1541..1931
[4] phenylalanine1711..1807
[4] MT2030..2129
[4] PCP2440..2507
[5] C2523..2823
[5] A3015..3431
[5] L-pipecolate3194..3300
[5] PCP3513..3580
[6] C3597..3897
[6] A4091..4495
[6] L-phenylglycine4259..4360
[6] PCP4579..4646
[6] TE4668..4899
[3] C22..921
[3] A1471..2652
[3] proline1939..2259
[3] PCP2896..3099
[4] C3145..4047
[4] A4621..5793
[4] phenylalanine5131..5421
[4] MT6088..6387
[4] PCP7318..7521
[5] C7567..8469
[5] A9043..10293
[5] L-pipecolate9580..9900
[5] PCP10537..10740
[6] C10789..11691
[6] A12271..13485
[6] L-phenylglycine12775..13080
[6] PCP13735..13938
[6] TE14002..14697

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [491-884]  1.20000000000001e-106 PF00501 [1541-1935]  1.99999999999999e-113 PF00501 [3015-3431]  8.70000000000003e-114 PF00501 [4091-4495]  4.69999999999992e-110 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [4668-4899]  1.6e-38 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [8-307]  9.20000000000002e-62 PF00668 [1049-1349]  1.60000000000002e-66 PF00668 [2523-2823]  3.70000000000004e-66 PF00668 [3597-3897]  5.00000000000001e-63 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [991-1006]  PS00012 [2465-2480]  PS00012 [3538-3553]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [970-1031]  1.1e-13 PF00550 [2444-2505]  1.9e-13 PF00550 [3517-3578]  1.4e-13 PF00550 [4582-4643]  1.2e-13 PF00550
PF00550   PP-binding
 [966-1033]  PS50075 [2440-2507]  PS50075 [3513-3580]  PS50075 [4579-4646]  PS50075
PS50075   ACP_DOMAIN
 [962-1037]  1.20000000000001e-105 G3DSA:1.10.1200.10 [2430-2510]  1.20000000000001e-105 G3DSA:1.10.1200.10 [3509-3581]  1.20000000000001e-105 G3DSA:1.10.1200.10 [4573-4647]  1.20000000000001e-105 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [959-1065]  6.19998763505952e-23 SSF47336 [2433-2508]  3.60000433965927e-21 SSF47336 [3506-3613]  7.30000590915208e-22 SSF47336 [4572-4647]  4.90001027782405e-20 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [491-884]  2.30000000000004e-128 TIGR01733 [1541-1935]  TIGR01733 [3015-3431]  1.9e-130 TIGR01733 [4091-4495]  1.60000000000002e-128 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013217 Methyltransferase type 12 (Domain)
 [2030-2129]  9.30000000000002e-10 PF08242
PF08242   Methyltransf_12
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [967-1036]  1.39999892049878e-10 SM00823 [2441-2510]  7.30000590915208e-09 SM00823 [3514-3583]  7.99999145876753e-10 SM00823 [4580-4649]  6.69999687625999e-08 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [599-610]  PS00455 [1663-1674]  PS00455 [3146-3157]  PS00455 [4213-4224]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit