close all open/close all

CDS information : Virg_00090


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction37,580 / 29,565 / - [in whole cluster]
9,204 / 1,189 / - [in contig]
Locationcomplement(29565..37580) [in whole cluster]
complement(1189..9204) [in contig]
TypeCDS
Length8,016 bp (2,671 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non ribosomal peptide synthetase for virginiamycin S
Gene
Gene (GenBank)visE
EC number
Keyword
  • virginiamycin S
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
Q54959
PmId
[9006024] Pristinamycin I biosynthesis in Streptomyces pristinaespiralis: molecular characterization of the first two structural peptide synthetase genes. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

S1 L-threonine
2 L-aminobutyric acid
C39..338
A541..947
PCP1033..1100
C1117..1417
A1607..2008
PCP2091..2157
E2196..2663

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non ribosomal peptide synthetase for virginiamycin S]
MQFDLVDPSGRLRLPPARRAAAAGSTGGEEMSGAKVASMALTDAQLGVWFAQARDPHSTA
FNTGEYVELTGPLDAGRFTAAVRAAVEATESLRLRFHTRADGEVRQRVVPADESAWELRH
VDVSAEPDPEAAADDLIRRQLAAPMAVDGEGPLFDQVLFTLGPGRHRWFQQVHHLLLDGY
GLRLVARRVADAYNGAGTPAEADDLAALVDAESAYRASRGHARDRAYWLTSWADRPEAPT
LGTGPVARGDAPAAAEGGAVPLRRTVFLPAAVQEGLDALARTAQTGWQVAALAAVALYTR
RLTGAGEAVLGLPVTNRRSSRARRTPAMLTNVPPLRVPARPDTDLTGLVTEVRDRVAEVL
RHQGYPYAELRRELGLLAQDRPLHSIVANIMPFDHGLDFEGIEAQVHPVSTGPVEDLKFS
VYERPGGAGLRIDVEADALRHREEEVAAHLARFTALLHSFATADPALPGGRLDVLAPGEH
VQAAGEAFVPEPSTDEPSTDEPSAHEPSTPDRPTTLPALFEAQAARTPQAVAVVDGHRQL
TYRELDARANRLAHLLTARGAGPERTVALALPRSADLVVALLAVVKTGAAYLPLDPDYPA
ERLASMLADAGPSVIVATAATRVVAPDRTALVLLDDEPQAGLPDTAPRTKHDPRHPAYVI
YTSGSTGRPKGVVVTHHNVVRLFTAAQQHFGFGPSDVWTLFHSYAFDFSVWEIWGPLLHG
GRLVVVPYSTSRSPGAFLDLLAEQRVTVLNQTPSAFYQLIEADRERPRPTALPALRHVVF
GGEALDAPRLEGWYERHGHTASLSNMYGITETTVHVTHTALDGPDGAPGSVGAPLADLRA
HVLDGALRPAPPGVTGELYVAGPGLARGYLGLPALTAERFVADPFAPAGDTGARMYRTGD
LVRRRADGTLEYVGRADHQVKIRGFRIELGEIEAALAALPSVAHAAVTAREDTPGDRRLA
AYAVPADGVPADPAAWRRELAAVLPAHQLPASFTPLDAIPLTVNGKLDRAALPAPGPAEA
ASWATQAAAAGPLEELLCRLFARILGVHEVGPRSDFFALGGHSVIANRLLSAARSELGVE
LTIEDLFARPTPAGLARLARGADTARPRLRPAGDPDGPAVLSPAQQRMWVIREVEGRAPT
YNMPLALRLTGALDRGAMQAALGDLIGRHDTLRTICPAGPDGPLPRVLPLDDVPPWLTET
EVAESDLAQALTSAAREPFDLDTQIPLRAHLFTLAPGEHVLLLVLHHIAGDGWSLRPLFG
DLAAAYDARSKGTAPRPEPLPVTYRDFALWQRELLGDESEPASLGARQLDHWHHALAGLP
DQLQLPYDRPRPPVARHRGGSVPLTIGPALHAQLDGLARTGGATVHMVLQAALAALLTRL
GAGTDVPIGCPTAGRDEEALDGLVGFFVNPVVVRADTSGDPAFAELLTRVRTTALAAYTH
QDVPFDRVVERLQPARSAARHPLFQVVLSYQESEARPRLAGLVVRREPVDFGVAKFDLTF
NLVEHRDDAGAPDGIHGDLEFDLDLFDPATAQAVARRLLALLEAVAAGPELPISRFDLVD
DAERAMLRRWNDTAAPVPDTGLAELFTAQARRTPDATALVAGDTELTYAQLDARAGALAA
RLTALGIGPECPVAVLQERSADLVVSLLAVLRAGGFYVPLNHRNPASRMSQIMTMAGARV
LLTDRAAHERHRCHAWAGQAEVVVVDDPAPASAPAPAAVVPGHPDRLAYVMYTSGSTGTP
KGVAITHRDVAVLAADRCWRTGNQQRVLLHSPYSFDTSQYELWVPLLSGGTVVVAPPGDL
DTAALREALTRGRVTGMWLTSGLFNLLAEESPECFRGVREVWTGGDVVSPAAVTRVLAAS
PDTLVVDGYGPTETTTFSTHHFMRAPWTEETTVPIGSPLDNTTCHVLDQRLRPVPPGVTG
ELYIGGARLARGYLGRPDATAERFVADPSGTPGARMYRTGDLVRRRADGILEFLGRADHQ
VKVRGFRIELGEIESVIGRHPTVAQSAVLVREDRPGDKRVTAYVVPAAAAAADAGELRRH
VAASLPDYMVPAAVVLLDRLPLTPNGKLDRRQLPVPEFAPAGDHRAPAGPREELLAGLFA
GVLGLEQVGTHDSFFDLGGDSIMAIQLVGRARRSGLLLSPAQVFEHKTVAALAGVATAAA
DSGPAPGTAPADDRAWGEVPLTPVMHWLRERGGPVEAFSQSLLVRVPAGLGEQRLATALR
ALADQHDMLRAVLSSDPDSGWRLRIEPPGGGSAEAWARRVDTAGHTDDALRTLITTEAAA
ARSRLDPWSGVMGQAVWFDAGQNRSGRLLLTLHHLVVDGVSWRILLPDLEAAWQAATGDT
APRPAPAGTSFRSWARHLAAEAARPARRAELDLWTGRLAAPALPVTDRPLDPARDTSATA
RSLTLTLPAAATEPLLTTVPATFHAKVDDVLLTAFALAVADWRARRGLGDASAVLLDLEG
HGREPGDSGADLSRTVGWFTSLYPVRLDVGPLDRRDALSGGPAAGQAVKRVKEQLRELPD
GGLGHGLLRHLNAETAPLLAALPTPDIGFNYLGRFKEPEGPDAEWTVTPDAESLGEGTDP
RLPMAHGVELNALTLDGPGGPRLTATWSWPQHLLDEGSVRDLGQGWFRALEALTAHAERP
DAGGHTPSDFSLVSLNQAQIDRLEAMWKVAR
selected fasta
>non-ribosomal peptide synthetase [non ribosomal peptide synthetase for virginiamycin S]
ATGCAATTCGATCTCGTCGACCCCAGTGGTCGGCTGCGCCTGCCCCCGGCCCGTCGGGCC
GCGGCGGCCGGCTCGACAGGAGGGGAAGAGATGAGTGGTGCCAAGGTCGCGTCCATGGCC
CTCACCGATGCACAGCTCGGTGTCTGGTTCGCCCAGGCCAGGGACCCGCACAGCACGGCG
TTCAACACCGGCGAGTACGTCGAGCTGACGGGCCCGCTGGACGCCGGGCGGTTCACCGCT
GCCGTGCGCGCCGCGGTCGAGGCCACCGAGTCCCTGCGCCTGCGCTTCCACACCCGCGCC
GACGGCGAAGTGCGCCAGCGGGTCGTCCCCGCGGACGAGTCGGCCTGGGAGCTGCGCCAC
GTCGACGTCAGCGCCGAACCCGACCCCGAGGCCGCCGCCGACGACCTGATCCGCCGGCAG
CTGGCCGCCCCGATGGCGGTCGACGGCGAAGGACCGCTGTTCGACCAGGTCCTGTTCACC
CTCGGCCCCGGCCGCCACCGCTGGTTCCAGCAAGTCCACCACCTGCTGCTCGACGGCTAC
GGGCTGCGCCTGGTGGCCCGGCGCGTCGCCGACGCCTACAACGGCGCGGGCACGCCGGCC
GAGGCCGACGACCTCGCCGCCCTGGTCGACGCCGAGAGTGCTTACCGTGCTTCGCGCGGC
CACGCCCGCGACCGCGCGTACTGGCTCACCTCCTGGGCTGACCGCCCGGAGGCACCCACC
CTGGGCACCGGTCCCGTCGCCCGGGGCGACGCCCCGGCGGCTGCCGAGGGCGGTGCCGTG
CCGCTGCGCCGCACGGTGTTCCTGCCCGCGGCCGTCCAGGAGGGCCTCGACGCGCTCGCC
CGCACCGCGCAGACCGGCTGGCAGGTGGCCGCTCTGGCCGCCGTCGCCCTCTACACCCGG
CGCCTGACCGGCGCCGGGGAGGCCGTACTGGGGCTCCCGGTCACCAACCGGCGCTCGAGC
AGAGCCCGCCGCACCCCCGCCATGCTCACCAACGTGCCGCCGCTGCGGGTGCCCGCCCGG
CCCGACACCGACCTCACCGGCCTGGTCACCGAGGTCCGCGACCGGGTCGCCGAGGTGCTG
CGGCACCAGGGCTACCCGTACGCCGAACTCCGCCGCGAACTGGGGCTGCTGGCGCAGGAC
CGCCCCCTGCACTCGATCGTCGCCAACATCATGCCGTTCGACCACGGCCTGGACTTCGAA
GGCATCGAGGCGCAGGTCCACCCGGTGTCGACCGGCCCCGTCGAGGACCTCAAGTTCTCG
GTGTACGAGCGTCCCGGCGGCGCCGGCCTGCGGATCGATGTCGAAGCCGACGCCCTGCGC
CACCGTGAGGAGGAGGTCGCCGCCCACCTGGCCCGTTTCACCGCCCTGCTGCATTCCTTC
GCCACCGCCGACCCCGCGCTGCCCGGCGGCCGGCTGGACGTCCTCGCCCCGGGCGAGCAC
GTGCAGGCCGCCGGCGAGGCGTTCGTGCCCGAGCCGTCCACCGACGAGCCGTCCACCGAC
GAGCCGTCCGCCCACGAGCCGTCCACCCCGGACCGTCCCACCACGCTGCCCGCCCTGTTC
GAGGCGCAGGCCGCCCGAACCCCGCAGGCCGTCGCCGTCGTCGACGGCCACCGGCAGCTC
ACCTACCGCGAACTCGACGCCAGGGCCAACCGCCTCGCCCACCTGCTCACGGCCCGCGGC
GCCGGCCCCGAGCGTACCGTCGCGCTCGCCCTGCCCCGCTCCGCCGACCTGGTCGTCGCC
CTGCTCGCGGTGGTCAAGACCGGCGCCGCCTACCTGCCGTTGGACCCGGACTACCCGGCC
GAGCGGCTGGCGTCCATGCTGGCCGACGCCGGCCCGTCCGTGATCGTCGCGACGGCCGCC
ACCCGGGTCGTCGCCCCCGACCGCACGGCCCTGGTCCTCCTTGACGACGAGCCGCAGGCC
GGCCTGCCCGACACCGCCCCGCGCACGAAGCACGACCCCCGCCACCCGGCCTACGTCATC
TACACCTCCGGCTCCACCGGCCGGCCCAAGGGCGTGGTCGTCACCCACCACAACGTGGTG
CGGCTGTTCACCGCCGCACAGCAGCACTTCGGCTTCGGCCCGTCGGACGTGTGGACGCTG
TTCCATTCCTACGCCTTCGACTTCTCCGTGTGGGAGATCTGGGGCCCGCTGCTGCACGGC
GGCCGCCTGGTCGTCGTCCCGTACTCCACCAGCCGTTCCCCCGGAGCCTTCCTCGACCTG
CTGGCCGAGCAGCGGGTCACGGTGCTCAACCAGACACCGTCCGCGTTCTACCAGCTGATC
GAGGCCGACCGGGAGCGGCCGCGGCCCACTGCCCTGCCCGCCCTGCGGCACGTCGTCTTC
GGCGGTGAGGCCCTGGATGCGCCCCGGCTGGAGGGCTGGTACGAGCGCCACGGCCACACT
GCGTCGCTGTCCAACATGTACGGGATCACCGAGACCACCGTGCACGTCACCCACACCGCC
CTCGACGGACCGGACGGCGCCCCTGGCTCCGTGGGCGCACCCCTCGCCGACCTCCGCGCC
CACGTGCTGGACGGAGCGCTACGCCCCGCGCCGCCCGGCGTCACCGGCGAGCTGTACGTC
GCGGGCCCCGGCCTCGCCCGCGGCTACCTCGGACTCCCCGCCCTCACCGCCGAGCGGTTC
GTCGCCGACCCCTTCGCGCCCGCCGGCGACACCGGCGCACGCATGTACCGCACCGGCGAC
CTGGTCCGCCGCCGCGCCGACGGCACCCTGGAGTACGTCGGCCGCGCCGACCACCAGGTG
AAGATCCGCGGGTTCCGCATCGAACTCGGCGAGATCGAGGCGGCGCTCGCCGCACTGCCG
TCGGTGGCCCACGCCGCGGTGACCGCCCGCGAGGACACCCCGGGCGACCGGCGGCTCGCG
GCGTACGCCGTCCCGGCCGACGGCGTCCCGGCCGACCCGGCCGCCTGGCGCCGCGAGCTC
GCCGCCGTACTGCCCGCCCACCAGCTGCCGGCCTCGTTCACCCCGCTCGACGCGATCCCG
CTCACCGTCAACGGCAAGCTCGACCGTGCCGCCCTGCCCGCCCCCGGCCCCGCCGAGGCC
GCGTCGTGGGCCACGCAGGCAGCCGCCGCCGGGCCGCTGGAAGAACTGCTGTGCCGCCTG
TTCGCACGCATCCTGGGCGTGCACGAAGTCGGACCGCGGAGCGACTTCTTCGCACTCGGC
GGGCACTCGGTGATCGCCAACCGGCTGCTGTCCGCAGCCCGCAGCGAGCTCGGCGTCGAG
CTGACCATCGAAGACCTCTTCGCCCGGCCCACCCCCGCCGGCCTCGCCCGGCTCGCCCGG
GGCGCCGACACCGCCCGCCCGCGACTGCGGCCCGCCGGCGACCCGGACGGACCGGCCGTC
CTCTCGCCCGCCCAGCAGCGCATGTGGGTGATACGCGAGGTCGAGGGCCGCGCCCCGACG
TACAACATGCCGCTTGCGTTGCGGCTCACCGGCGCACTGGACCGCGGCGCGATGCAAGCC
GCCCTCGGCGACCTGATCGGCCGCCACGACACCCTGCGCACCATCTGCCCGGCCGGACCG
GACGGCCCGCTGCCCCGGGTGCTGCCGCTCGACGACGTCCCGCCGTGGCTGACCGAGACC
GAGGTGGCCGAATCGGATCTGGCGCAGGCCCTCACCTCGGCCGCGCGCGAACCGTTCGAC
CTCGACACGCAGATCCCGCTGCGCGCCCACCTGTTCACCCTGGCCCCCGGCGAGCACGTC
CTGCTGCTGGTTCTGCACCACATCGCCGGGGACGGCTGGTCGCTGCGCCCGCTCTTCGGC
GACCTCGCCGCCGCCTACGACGCCCGCTCCAAGGGCACGGCACCCCGCCCGGAGCCGCTG
CCCGTCACCTACCGGGACTTCGCGCTCTGGCAGCGCGAACTGCTCGGCGACGAGAGCGAG
CCGGCCTCCCTGGGCGCCCGCCAGCTCGACCACTGGCACCACGCGCTGGCCGGCCTGCCC
GACCAGCTCCAGCTCCCCTACGACCGCCCCCGCCCGCCGGTCGCCCGGCACCGCGGCGGC
TCGGTGCCGCTGACCATCGGCCCCGCGCTGCACGCGCAGCTCGACGGGCTCGCCCGCACC
GGCGGCGCCACCGTCCACATGGTCCTCCAAGCCGCCCTGGCCGCACTGCTCACCAGGCTC
GGCGCCGGCACCGACGTCCCCATCGGCTGCCCCACCGCCGGCCGGGACGAGGAGGCCCTC
GACGGGCTCGTCGGCTTCTTCGTCAACCCCGTCGTGGTCCGCGCCGACACCTCCGGCGAC
CCGGCCTTCGCCGAACTCCTCACTCGCGTACGCACCACCGCGCTGGCCGCCTACACCCAC
CAGGACGTGCCCTTCGACCGCGTGGTGGAGCGCCTTCAGCCGGCCCGCTCCGCCGCCCGG
CACCCGCTTTTCCAGGTGGTGCTCTCGTACCAGGAGTCCGAGGCCCGGCCGCGGCTGGCC
GGACTCGTCGTGCGTCGCGAACCGGTCGACTTCGGCGTCGCCAAGTTCGACCTCACCTTC
AACCTGGTCGAGCACCGCGACGACGCGGGTGCCCCCGACGGCATCCACGGCGACCTCGAG
TTCGACCTCGACCTGTTCGACCCCGCGACCGCGCAGGCCGTCGCCCGCCGGCTGCTGGCC
CTGCTGGAGGCCGTCGCCGCCGGCCCCGAACTGCCGATCAGCCGGTTCGACCTGGTCGAT
GACGCCGAGCGGGCCATGCTGCGCCGGTGGAACGACACCGCCGCCCCGGTCCCGGACACC
GGTCTCGCCGAGCTGTTCACCGCCCAGGCGCGCCGCACCCCCGACGCGACGGCCCTGGTG
GCCGGCGACACCGAGCTGACCTACGCCCAGCTCGACGCCCGGGCCGGCGCCCTCGCCGCC
CGGCTCACCGCCCTGGGCATCGGCCCGGAGTGCCCCGTCGCCGTGCTCCAGGAACGTTCC
GCGGACCTGGTGGTGTCCCTCTTGGCCGTACTGCGGGCAGGCGGCTTCTACGTCCCGCTC
AACCACCGGAACCCGGCCTCCCGGATGAGTCAGATCATGACCATGGCCGGGGCCCGGGTC
CTGCTGACCGACCGGGCCGCACACGAAAGGCACCGCTGCCACGCATGGGCCGGGCAGGCC
GAGGTGGTCGTCGTGGACGATCCCGCGCCCGCGTCGGCGCCCGCCCCCGCCGCGGTCGTC
CCGGGCCACCCCGACCGGCTGGCGTACGTGATGTACACCTCCGGCTCCACCGGCACGCCC
AAGGGCGTCGCCATCACCCACCGGGACGTCGCCGTGCTCGCCGCCGACCGCTGCTGGCGC
ACCGGCAACCAGCAGCGGGTACTGCTGCACTCCCCGTACTCGTTCGACACCTCCCAGTAC
GAGCTGTGGGTGCCGCTGCTGTCCGGCGGGACCGTCGTGGTCGCCCCGCCCGGGGACCTC
GACACCGCCGCTCTCCGCGAGGCCCTCACGCGCGGACGGGTCACCGGCATGTGGCTCACC
TCCGGGCTGTTCAACCTGCTCGCCGAGGAGAGCCCCGAATGCTTCCGCGGCGTGCGCGAG
GTGTGGACCGGAGGTGACGTGGTCTCGCCCGCTGCCGTCACCCGGGTCCTGGCCGCCTCC
CCGGACACGCTGGTCGTCGACGGCTACGGCCCGACCGAGACCACGACCTTCTCCACCCAC
CACTTCATGCGCGCCCCGTGGACCGAGGAGACCACCGTCCCGATCGGCAGCCCCCTCGAC
AACACCACCTGCCACGTCCTCGACCAGCGGCTTCGCCCCGTGCCGCCGGGAGTCACCGGC
GAGCTCTACATCGGCGGCGCCCGTCTCGCCCGCGGCTACCTCGGCCGCCCCGACGCCACC
GCCGAACGGTTCGTGGCCGACCCGTCCGGTACGCCCGGCGCACGCATGTACCGCACCGGC
GACCTGGTGCGCCGCCGCGCCGACGGCATCCTGGAGTTCCTCGGCCGCGCCGACCACCAG
GTCAAGGTCCGCGGCTTCCGCATCGAACTCGGCGAGATCGAGTCCGTCATCGGCCGCCAC
CCCACCGTCGCGCAGAGCGCCGTACTCGTACGCGAGGACCGCCCCGGCGACAAGCGGGTC
ACCGCCTACGTGGTGCCCGCCGCGGCAGCCGCGGCCGACGCCGGCGAACTGCGCCGGCAC
GTCGCCGCGTCCCTGCCCGACTACATGGTCCCGGCCGCCGTCGTGCTGCTGGACCGGCTG
CCCCTGACCCCCAACGGCAAGCTCGACCGCCGGCAGCTGCCCGTCCCCGAGTTCGCCCCC
GCAGGCGACCACCGGGCCCCTGCCGGCCCCCGCGAGGAACTGCTCGCCGGCCTGTTCGCC
GGCGTCCTCGGCCTGGAGCAGGTCGGTACCCACGACAGCTTCTTCGACCTGGGCGGCGAC
AGCATCATGGCGATCCAGCTGGTCGGCCGCGCCCGCCGGTCCGGCCTGCTGCTCTCGCCC
GCCCAGGTCTTCGAGCACAAGACCGTCGCCGCCCTGGCCGGCGTCGCCACCGCCGCGGCC
GACAGCGGACCGGCCCCCGGCACCGCACCGGCGGACGACCGGGCCTGGGGCGAGGTACCG
CTCACCCCGGTCATGCACTGGCTGCGCGAACGCGGCGGCCCCGTCGAGGCGTTCAGCCAG
TCCCTGCTCGTCCGGGTGCCGGCCGGGCTCGGCGAGCAGCGCCTGGCCACCGCCCTGCGC
GCCCTCGCCGACCAGCACGACATGCTGCGCGCGGTCCTGTCCTCCGACCCGGACAGCGGT
TGGCGGCTGCGCATCGAACCGCCCGGCGGCGGCAGCGCCGAAGCCTGGGCCCGCAGGGTC
GACACCGCCGGCCACACCGACGACGCACTGCGCACCCTGATCACCACCGAGGCGGCCGCC
GCACGCAGCCGGCTCGACCCCTGGTCGGGCGTGATGGGACAGGCCGTCTGGTTCGACGCC
GGCCAGAACCGGTCCGGACGCCTGCTGCTCACCCTCCACCACCTGGTGGTCGACGGCGTG
TCCTGGCGCATCCTGCTGCCCGACCTGGAGGCCGCCTGGCAGGCAGCGACCGGGGACACC
GCCCCGCGCCCGGCGCCCGCCGGCACCTCCTTCCGCAGCTGGGCCCGGCACCTGGCCGCC
GAGGCCGCCCGTCCCGCCCGCCGCGCCGAACTCGACCTGTGGACCGGCCGCCTGGCCGCG
CCCGCCCTACCCGTCACCGACCGGCCGCTCGACCCCGCCCGGGACACCTCCGCCACCGCA
CGCAGCCTCACCCTGACCCTCCCGGCGGCCGCCACCGAACCCCTGCTCACCACCGTGCCC
GCCACGTTCCACGCCAAGGTCGACGACGTCCTGCTCACCGCCTTCGCGCTGGCCGTCGCC
GATTGGCGGGCCCGCCGCGGTCTCGGCGACGCGTCAGCCGTCCTGCTCGACCTGGAGGGC
CACGGCCGCGAACCGGGCGACAGCGGCGCCGATCTGTCCCGTACCGTCGGCTGGTTCACC
AGCCTCTACCCCGTACGCCTCGACGTCGGCCCGCTCGATCGCCGCGACGCCCTGTCCGGC
GGCCCCGCGGCCGGACAGGCTGTCAAACGGGTCAAGGAACAGCTGCGGGAACTTCCCGAC
GGCGGCCTCGGCCATGGCCTCCTGCGCCACCTGAACGCCGAGACCGCGCCGCTCCTGGCC
GCACTGCCGACGCCCGACATCGGCTTCAACTACCTGGGCCGCTTCAAGGAGCCGGAAGGG
CCGGACGCCGAATGGACCGTCACCCCCGACGCCGAATCCCTCGGTGAGGGCACCGACCCC
CGACTGCCGATGGCCCACGGCGTCGAGCTGAACGCCCTCACTCTGGACGGCCCGGGCGGC
CCCCGCCTGACCGCCACCTGGAGTTGGCCGCAGCACCTGCTCGACGAGGGCTCCGTACGC
GACCTCGGACAGGGCTGGTTCCGCGCCCTCGAAGCCCTCACCGCCCACGCCGAGCGCCCC
GACGCCGGCGGGCACACCCCGTCCGACTTCTCCCTGGTCTCCCTGAACCAGGCCCAGATC
GACCGACTCGAAGCCATGTGGAAGGTTGCCCGATGA
[1] C39..338
[1] A541..947
[1] L-threonine707..815
[1] PCP1033..1100
[2] C1117..1417
[2] A1607..2008
[2] L-aminobutyric acid1776..1877
[2] PCP2091..2157
[2] E2196..2663
[1] C115..1014
[1] A1621..2841
[1] L-threonine2119..2445
[1] PCP3097..3300
[2] C3349..4251
[2] A4819..6024
[2] L-aminobutyric acid5326..5631
[2] PCP6271..6471
[2] E6586..7989

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [541-947]  5.20000000000001e-126 PF00501 [1607-2008]  1.99999999999999e-111 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [39-338]  8.20000000000006e-40 PF00668 [1117-1417]  1.80000000000002e-62 PF00668 [2196-2489]  8.00000000000001e-37 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1058-1073]  PS00012 [2116-2131]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1026-1101]  9.40000000000003e-48 G3DSA:1.10.1200.10 [2083-2158]  9.40000000000003e-48 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1036-1098]  7e-12 PF00550 [2095-2153]  1.3e-11 PF00550
PF00550   PP-binding
 [1033-1100]  PS50075 [2091-2157]  PS50075
PS50075   ACP_DOMAIN
 [1026-1133]  7.60000011115812e-20 SSF47336 [2084-2158]  4.40000933643891e-18 SSF47336
SSF47336   ACP_like
IPR010060 Non-ribosomal peptide synthase (Domain)
 [2504-2663]  5.49999999999995e-44 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [541-947]  TIGR01733 [1607-2008]  4.10000000000004e-130 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [659-670]  PS00455 [1730-1741]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-22]  0.504 Signal
Bacteria, Gram-positive   
TMHMM No significant hit