close all open/close all

CDS information : Virg_00100


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction38,478 / 37,645 / - [in whole cluster]
10,102 / 9,269 / - [in contig]
Locationcomplement(37645..38478) [in whole cluster]
complement(9269..10102) [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative two component regulator
Gene
Gene (GenBank)vmsT
EC number
Keyword
  • virginiamycin M
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[19332826] Hierarchical control of virginiamycin production in Streptomyces virginiae by three pathway-specific regulators: VmsS, VmsT and VmsR. (Microbiology. , 2009)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative two component regulator]
MERRAQGWPASSGTAALRVLPGGAGPARPRSSRHTLLPPLADRAAPPAAYPWAPAHDDLV
RSEEPAPDGADTVRVFLLGPDALARAGLRALLESQPGVVVAAEGEPGPRALADLRISCPD
VMVLHGVPDPQLIGLPGSQDPGGTPLLAVGGPDPAEPGPHLNGCLPATVTPADLAAAVRM
AAAGYHLSRRPSRRTADDGGFRRAEVSDVDPDELTARESEVLDLIARGLSNAEIAGALML
SEHTVKSHVQNLLGKLRLRSRVQAVVYAYEIGLRRTR
selected fasta
>putative LuxR family transcriptional regulator [putative two component regulator]
ATGGAACGGCGAGCACAGGGCTGGCCCGCATCCAGTGGGACCGCCGCGCTGCGGGTCCTG
CCCGGCGGAGCCGGGCCGGCCCGGCCCCGCAGCAGCCGCCACACCCTCCTGCCCCCGCTC
GCGGACCGGGCCGCGCCGCCGGCCGCGTACCCGTGGGCGCCGGCCCACGACGACCTCGTT
CGGTCCGAGGAGCCCGCGCCCGACGGTGCGGACACCGTCCGGGTCTTCCTGCTGGGGCCC
GACGCGCTCGCCCGGGCCGGCCTGCGCGCCCTGCTGGAGAGCCAGCCCGGGGTCGTGGTC
GCGGCGGAGGGCGAACCCGGCCCCCGGGCCCTGGCAGACCTGAGGATCAGCTGCCCCGAC
GTCATGGTGCTCCACGGGGTGCCGGACCCGCAGCTGATCGGGTTGCCCGGAAGCCAGGAC
CCCGGCGGGACACCGCTGCTGGCCGTCGGCGGCCCGGATCCGGCCGAACCCGGCCCCCAT
CTGAACGGCTGCCTCCCCGCGACGGTGACGCCCGCGGACCTCGCCGCCGCGGTGCGGATG
GCCGCCGCCGGCTACCACCTGAGCCGTCGGCCGTCCCGGCGGACGGCCGACGACGGAGGA
TTCCGCCGCGCCGAGGTCTCCGACGTCGACCCCGACGAGCTGACGGCCCGGGAGAGCGAG
GTGCTGGACCTGATCGCCCGCGGCCTGTCCAACGCGGAGATCGCCGGTGCGCTGATGCTC
TCGGAGCACACCGTCAAGTCCCATGTGCAGAACCTGCTGGGCAAGCTCCGGTTGCGCAGC
CGCGTCCAGGCGGTGGTCTACGCGTATGAGATCGGGCTGCGGCGAACCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [214-228]  1e-13 PR00038 [228-244]  1e-13 PR00038 [244-256]  1e-13 PR00038
PR00038   HTHLUXR
 [207-272]  PS50043
PS50043   HTH_LUXR_2
 [228-255]  PS00622
PS00622   HTH_LUXR_1
 [211-268]  1.60000240695997e-26 SM00421
SM00421   HTH_LUXR
 [212-268]  4.40000000000001e-20 PF00196
PF00196   GerE
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [205-273]  4.5e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [192-274]  3.69999438558106e-20 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit