close all open/close all

CDS information : Virg_00110


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction39,048 / 40,268 / + [in whole cluster]
10,672 / 11,892 / + [in contig]
Location39048..40268 [in whole cluster]
10672..11892 [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)Favin-dependent oxidoreductase
Gene
Gene (GenBank)virN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[19332826] Hierarchical control of virginiamycin production in Streptomyces virginiae by three pathway-specific regulators: VmsS, VmsT and VmsR. (Microbiology. , 2009)
Family/Domain
FD
IPR011251

close this sectionSequence

selected fasta
>putative oxidoreductase [Favin-dependent oxidoreductase]
MRPRPPARISFCSPGTFTDHPAPFTHCPRTEPSDGVVMEFGVNFFPVVDPERKTAAEYYA
ESLRLVELAESLGYEHAQIVEHYGSPYGGYSPDPVAFLAAAAARTSRIRLATGAVIAAFT
HPVKLAANLAMLDNLSHGRLDVGFGRAFLPDEFEAFGVPIEESRSRFDDGIAACIALWTE
ENTVFEGAVHRFGPFTGFPRPYQQPHPPVFVASASSPDSCAAAGRAGHHLQVVPSVTTRQ
GLKEMIEGYRQARAEAGHPSGGRIQVKYTCYVSEDRDLALADAREQEQNYVSRMAEAVSS
WAHTRSSQYPGYERFVEKARGYDFDRALTDGKVLAGTPQDVTEQVREIAAEYGSDLCLSL
QFSPGHLPFERAARAMELFALQVAPSFTGRAGAAAGAEAVAVPAAG
selected fasta
>putative oxidoreductase [Favin-dependent oxidoreductase]
ATGCGACCGCGGCCGCCCGCCCGGATATCGTTCTGCTCTCCGGGCACATTCACCGATCAT
CCCGCCCCATTTACTCACTGCCCCCGCACCGAACCTTCGGACGGAGTCGTCATGGAATTC
GGAGTCAATTTCTTCCCGGTCGTGGACCCGGAACGGAAAACTGCCGCCGAGTATTACGCC
GAGAGTCTTCGGCTGGTCGAACTGGCCGAGTCGCTCGGCTATGAACACGCACAGATCGTC
GAGCACTACGGCTCCCCGTACGGCGGCTACAGTCCCGATCCGGTGGCGTTCCTGGCCGCC
GCCGCCGCGCGGACCAGCCGCATCCGGCTCGCGACCGGCGCCGTCATCGCCGCCTTCACC
CACCCCGTCAAGCTCGCCGCCAACCTGGCGATGCTCGACAACCTCTCGCACGGCCGCCTC
GACGTCGGCTTCGGACGGGCCTTCCTGCCCGACGAGTTCGAGGCCTTCGGCGTGCCGATC
GAGGAGAGCCGCTCCCGTTTCGACGACGGCATCGCGGCCTGCATCGCGCTGTGGACCGAG
GAGAACACGGTCTTCGAGGGCGCCGTCCACCGGTTCGGGCCCTTCACCGGCTTCCCCCGC
CCCTACCAGCAGCCCCACCCGCCGGTGTTCGTCGCCTCCGCCAGCAGCCCGGACTCCTGC
GCGGCAGCCGGCCGGGCCGGCCACCACCTCCAGGTCGTACCCTCGGTGACCACCCGTCAG
GGCCTGAAGGAGATGATCGAGGGCTACCGGCAGGCACGCGCCGAGGCCGGGCACCCGAGC
GGCGGGCGGATCCAGGTGAAGTACACCTGCTACGTGTCCGAGGACCGCGATCTGGCGCTG
GCGGACGCCCGCGAGCAGGAGCAGAACTACGTGTCCCGGATGGCCGAGGCGGTCTCGTCC
TGGGCGCACACCCGCAGCAGCCAGTACCCCGGCTACGAGCGGTTCGTGGAGAAGGCCCGC
GGTTACGACTTCGACCGGGCGCTCACCGACGGCAAGGTCCTCGCCGGCACCCCGCAGGAC
GTCACCGAGCAGGTCCGCGAGATCGCCGCCGAGTACGGGTCGGACCTGTGCCTGAGCCTG
CAGTTCAGCCCCGGCCACCTGCCGTTCGAGCGGGCCGCGCGGGCCATGGAGCTGTTCGCC
CTGCAGGTCGCCCCCTCCTTCACCGGCCGGGCCGGTGCGGCCGCCGGGGCGGAGGCCGTC
GCGGTGCCGGCAGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [38-353]  2.80000000000001e-60 PF00296
PF00296   Bac_luciferase
 [38-390]  1.79999999999997e-87 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [38-391]  3.99998544139406e-76 SSF51679
SSF51679   Luciferase_like
SignalP No significant hit
TMHMM No significant hit