close all open/close all

CDS information : Virg_00120


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction40,372 / 41,529 / + [in whole cluster]
11,996 / 13,153 / + [in contig]
Location40372..41529 [in whole cluster]
11996..13153 [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)Sarcosine oxidase
Gene
Gene (GenBank)virM
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[19332826] Hierarchical control of virginiamycin production in Streptomyces virginiae by three pathway-specific regulators: VmsS, VmsT and VmsR. (Microbiology. , 2009)
Related Reference
ACC
P40859
PmId
[10913293] Monomeric sarcosine oxidase: 2. Kinetic studies with sarcosine, alternate substrates, and a substrate analogue. (Biochemistry. , 2000)
[10220347] Structure of the flavocoenzyme of two homologous amine oxidases: monomeric sarcosine oxidase and N-methyltryptophan oxidase. (Biochemistry. , 1999)

close this sectionSequence

selected fasta
>putative oxidoreductase [Sarcosine oxidase]
MARTATGLDAEAAVVGLGAWGACSLWQLARQGVDVIGIDRYGIGNVHGSSYGESRMFRTA
CLEHPGLVPLAQRSRELWAELEEQTGRVLMERTGAMLIGPPDGRIVGGALRAAREHRLDI
ELLDPASMRERVPAHAGLPDDHVGVLEPAGGLTYPEHTIAAAVDAARAAGARVVTDTRVT
AVEPGNDGIVVRTALRTLRVARLVVAAGPWLSQLVPGLPLDVLRMPTTWFTPAEPDPRFT
LERLPVFMRELADGNVIWGHGTLPGGTEVKLGLEDGGRHFRVVDPENMDRSVSPADWSVL
SRILPAAVPGLGDTPSRATANLYARTPDGQFLLGPLRHDPRIIVAGGCNSHGFKHATGIG
EAVADMVRGRTPAVPLGFADPNSLR
selected fasta
>putative oxidoreductase [Sarcosine oxidase]
ATGGCCCGTACAGCCACCGGCCTGGACGCCGAGGCCGCCGTCGTGGGGCTGGGCGCCTGG
GGCGCCTGCTCCCTGTGGCAGCTGGCCCGGCAGGGGGTCGACGTCATCGGCATCGACCGC
TACGGCATCGGCAACGTGCACGGTTCCTCGTACGGCGAGAGCCGCATGTTCCGCACCGCC
TGCCTGGAGCACCCGGGCCTGGTCCCGCTCGCGCAGCGCTCGCGCGAGCTGTGGGCCGAG
CTGGAGGAGCAGACCGGCCGGGTGCTGATGGAGCGGACCGGGGCCATGCTGATCGGCCCG
CCGGACGGGCGCATCGTCGGCGGCGCGCTGCGGGCGGCCCGCGAGCACCGGCTGGACATC
GAGCTGCTCGACCCGGCGAGCATGCGCGAGCGGGTCCCCGCGCATGCCGGGCTGCCGGAC
GACCATGTGGGCGTGCTGGAGCCGGCCGGCGGGCTGACCTACCCCGAGCACACCATCGCC
GCCGCGGTCGACGCGGCGCGGGCGGCCGGGGCCCGGGTGGTCACCGACACCCGGGTCACC
GCGGTCGAACCCGGCAACGACGGCATCGTGGTGCGCACCGCGTTGCGGACGCTCCGTGTC
GCCCGGCTCGTGGTGGCCGCGGGCCCGTGGCTGTCCCAGCTGGTGCCGGGGCTCCCCCTC
GACGTGCTGCGCATGCCCACGACCTGGTTCACCCCGGCCGAGCCCGATCCGCGGTTCACC
CTGGAGCGGCTGCCGGTGTTCATGCGCGAACTCGCCGACGGGAACGTGATCTGGGGCCAC
GGCACCCTGCCCGGCGGCACCGAGGTGAAGCTCGGGCTGGAGGACGGCGGACGCCACTTC
CGCGTCGTCGACCCCGAGAACATGGACCGCTCGGTCTCCCCCGCCGACTGGTCGGTGCTC
TCCCGCATCCTCCCGGCGGCCGTGCCCGGCCTCGGCGACACCCCCTCGCGGGCGACGGCC
AACCTGTACGCGCGCACCCCCGACGGCCAGTTCCTCCTCGGCCCGCTGCGGCACGACCCG
CGGATCATCGTCGCGGGCGGGTGCAACAGCCACGGTTTCAAGCACGCGACCGGGATCGGC
GAGGCCGTCGCCGACATGGTCCGCGGCAGGACCCCGGCCGTCCCGCTCGGTTTCGCTGAC
CCGAACTCCCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006076 FAD dependent oxidoreductase (Domain)
 [12-366]  5.7e-51 PF01266
PF01266   DAO
SignalP No significant hit
TMHMM No significant hit