close all open/close all

CDS information : Virg_00130


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction41,580 / 42,569 / + [in whole cluster]
13,204 / 14,193 / + [in contig]
Location41580..42569 [in whole cluster]
13204..14193 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)pathway specific regulatory protein
Gene
Gene (GenBank)vmsS
EC number
Keyword
  • SARP family
Note
  • This ORF is involved in both virginiamycin M and virginiamycin S biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
[19332826] Hierarchical control of virginiamycin production in Streptomyces virginiae by three pathway-specific regulators: VmsS, VmsT and VmsR. (Microbiology. , 2009)
Related Reference
ACC
P16922
PmId
[2294088] Nucleotide sequence and transcriptional analysis of the redD locus of Streptomyces coelicolor A3(2). (J Bacteriol. , 1990)

close this sectionSequence

selected fasta
>transcriptional activator [pathway specific regulatory protein]
MQFRILGPVEIHDERRGLRIVPTGSKQRVLLGALVVKAGHLVSYHRLIDELWGEHPPANP
ANALQAHVARLRKLLEDAGSTGQERIDTHALGYQLHTGPDATDAGRFHRLCAQGRAVIAT
DPERAVHLLRQALALWRGPALQGSLGGDICLAEAAQLEENRLVALETLYEAGLRAGLHHE
ITGELEELIGDNPVRERFYELLMVALHRCGRQAEALGTYERARTRLADELGVEPGAALHR
RVRSILSPGREQPAPAAARSAAPMVRSLPPRPDTAGRRAASTAPRGGAVVLDLGDELARL
RRRLENLTREQEDLARRMDQLTARTAAAR
selected fasta
>transcriptional activator [pathway specific regulatory protein]
ATGCAGTTCCGCATTCTCGGCCCTGTAGAGATCCACGACGAGCGGCGCGGCCTGCGGATC
GTACCCACGGGCTCCAAGCAGCGCGTCCTGCTCGGCGCCCTGGTCGTGAAGGCCGGCCAT
CTGGTGTCGTACCACCGCCTGATCGACGAGTTGTGGGGCGAACACCCGCCGGCGAACCCG
GCCAACGCCCTCCAGGCCCACGTCGCCCGGCTCAGGAAGCTGTTGGAGGACGCCGGATCG
ACCGGTCAGGAGCGGATCGACACCCACGCGCTGGGCTACCAGCTGCACACCGGGCCGGAC
GCGACCGACGCCGGCAGGTTCCACCGGCTGTGCGCCCAGGGCCGGGCCGTGATCGCCACC
GACCCCGAGCGGGCCGTCCACCTGCTGCGCCAGGCACTCGCCCTGTGGCGGGGGCCCGCG
TTGCAGGGCAGCCTCGGCGGGGACATCTGCCTGGCGGAGGCCGCCCAGCTGGAGGAGAAC
CGGCTGGTCGCCCTGGAAACGCTCTACGAGGCCGGCCTGCGGGCGGGCCTGCACCACGAG
ATCACCGGCGAGCTGGAGGAGCTCATCGGTGACAATCCGGTGCGGGAGCGGTTCTACGAG
CTGCTGATGGTCGCCCTCCACCGCTGCGGCCGGCAGGCGGAGGCGCTCGGCACGTACGAG
CGGGCCCGGACGCGTCTGGCCGATGAACTCGGGGTGGAACCCGGTGCGGCGCTGCACCGA
CGGGTCCGGTCGATCCTCAGCCCCGGCCGCGAGCAGCCGGCCCCCGCTGCGGCGCGCTCG
GCGGCGCCGATGGTCCGCTCCCTCCCGCCACGGCCCGACACCGCTGGTCGGCGGGCTGCA
TCGACGGCTCCCCGGGGCGGGGCCGTCGTCCTCGACCTCGGCGACGAACTGGCGCGACTG
CGAAGGCGGTTGGAGAACCTGACCCGCGAGCAGGAGGACCTGGCCCGCCGGATGGACCAG
CTCACCGCCCGCACCGCGGCCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [21-95]  1.9e-13 PF00486
PF00486   Trans_reg_C
 [17-95]  5.09999882439978e-12 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [102-246]  1.40000506907309e-49 SM01043
SM01043   BTAD
 [102-246]  6.59999999999996e-45 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [25-96]  2.3e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-96]  9.20000434662057e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-38]  0.267 Signal
Bacteria, Gram-positive   
TMHMM No significant hit