close all open/close all

CDS information : Virg_00140


close this sectionLocation

Organism
StrainMAFF 10-06014
Entry nameVirginiamycin
Contig
Start / Stop / Direction44,298 / 42,625 / - [in whole cluster]
15,922 / 14,249 / - [in contig]
Locationcomplement(42625..44298) [in whole cluster]
complement(14249..15922) [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)ABC-transporter protein
Gene
Gene (GenBank)varL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17350183] Characterization of biosynthetic gene cluster for the production of virginiamycin M, a streptogramin type A antibiotic, in Streptomyces virginiae. (Gene. , 2007)
Related Reference
ACC
Q53712
PmId
[7565095] A second ABC transporter is involved in oleandomycin resistance and its secretion by Streptomyces antibioticus. (Mol Microbiol. , 1995)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [ABC-transporter protein]
MIATARAADATVHLAADSVTRIRGDRTVLNGISLTVSAGERLGLIGDNGVGKSTLLRVLA
GLDAPDGGRVRVGLGGGTPGYLSQEPDLPADWDLARCLAEARREIDRIAARMHEVEQLMA
AAEDTEPAALLDEYAVLQEDFEARDGWRFEARASEVFQALGLHRLPSERPAGQLSGGERA
RLGLALLVLQEPPALLLDEPTNHLDDEAVEWLARWLREFRGPCLIASHDRDLLDGAVTGL
LDLDGPRGSVVRYGGTYRDYAAAQAAARRRWEADYENWTESLAAAQLRLNRSDRAAGHYR
PPRDNAKMNYDLRGAGAQAAVARTARAAKEEIRRLELQAVPRPPAPLSFTAVGLGDRAGR
GAAEPGQEAGPLIELRDVRTAQGIRLPELALTGTDRLVVAGPNGAGKSTLLRILAGELEP
GSGTVATRPGVRVGHLSQESEYPAGRVPLLRTHAQVIAATEDEAAEQLLELGLFRPADLQ
VPVGALSAGQRRRLDLARLVAMRPHVLLLDEPTNHLSLPLIEDLQTALDEFPGPVVTVTH
DRRMRRSAGRTLLLERD
selected fasta
>putative ABC transporter ATP-binding protein [ABC-transporter protein]
ATGATCGCAACCGCACGGGCGGCGGACGCGACCGTCCATCTCGCGGCCGACTCCGTGACC
AGGATCCGCGGCGACCGCACTGTCCTCAACGGCATCTCGCTGACCGTCTCGGCCGGCGAA
CGCCTCGGCCTCATCGGGGACAACGGCGTCGGCAAGTCCACCCTGCTCCGGGTTCTGGCC
GGCCTCGACGCCCCGGACGGCGGCCGTGTCCGGGTCGGCCTCGGCGGAGGCACCCCCGGC
TACCTCTCCCAGGAACCCGACCTGCCCGCCGACTGGGACCTCGCCCGCTGCCTGGCCGAG
GCCCGCCGCGAGATCGACCGGATCGCGGCGCGGATGCACGAGGTCGAGCAGCTGATGGCC
GCGGCCGAAGACACGGAGCCGGCCGCGCTCCTCGACGAGTACGCCGTGCTCCAGGAGGAC
TTCGAAGCCCGCGACGGCTGGCGCTTCGAGGCCAGGGCGTCCGAGGTCTTCCAGGCGCTC
GGCCTGCACCGGCTGCCGTCCGAGCGGCCGGCCGGGCAGCTCTCCGGCGGTGAGCGGGCC
CGGCTCGGTCTCGCCCTGCTCGTCCTCCAAGAGCCGCCCGCCCTGCTGCTGGACGAGCCC
ACCAACCACCTCGACGACGAGGCCGTCGAGTGGCTCGCGCGGTGGCTCCGCGAGTTCAGG
GGACCCTGCCTGATCGCTTCCCACGACCGCGACCTGCTGGACGGCGCCGTCACCGGACTG
CTGGACCTGGACGGACCGCGCGGGTCGGTGGTCCGATACGGCGGAACCTACCGCGACTAC
GCCGCCGCGCAGGCCGCCGCCCGGCGGCGCTGGGAGGCGGACTACGAGAACTGGACCGAG
TCGCTCGCCGCCGCCCAGCTCCGGCTCAACCGCTCCGACCGGGCCGCCGGGCACTACCGG
CCGCCCCGCGACAACGCCAAGATGAACTACGACCTGCGCGGCGCCGGAGCCCAGGCGGCG
GTGGCACGCACCGCCCGCGCCGCCAAGGAGGAGATCAGGCGGCTCGAACTCCAGGCGGTG
CCGCGGCCGCCCGCCCCGCTGAGCTTCACCGCGGTCGGCCTCGGCGACCGGGCGGGCCGG
GGAGCCGCGGAGCCCGGGCAGGAGGCCGGCCCGCTGATCGAGCTCAGGGACGTCCGCACG
GCCCAGGGCATCCGGCTGCCCGAACTCGCCCTGACCGGCACCGACCGGTTGGTGGTCGCG
GGGCCGAACGGGGCGGGCAAGTCGACGCTGCTGCGGATTCTCGCGGGGGAGCTGGAGCCC
GGATCCGGCACCGTCGCCACCCGTCCGGGCGTACGGGTCGGCCACTTGTCCCAGGAGAGC
GAATACCCGGCCGGCCGGGTCCCGCTGCTGCGCACGCACGCACAGGTGATCGCCGCGACC
GAGGACGAGGCGGCGGAGCAGTTGCTGGAGCTGGGCCTGTTCCGCCCGGCCGATCTCCAG
GTACCCGTCGGCGCGCTGAGCGCCGGTCAGCGCAGGCGGCTCGACCTGGCCAGGCTGGTG
GCGATGCGTCCGCACGTCCTGCTGCTGGACGAGCCCACCAACCATCTGAGCCTGCCGCTG
ATCGAAGACCTGCAGACGGCGCTGGACGAGTTCCCCGGCCCGGTGGTCACCGTCACGCAC
GACCGCCGGATGCGCAGGTCGGCGGGCCGGACGCTGCTGCTGGAGCGGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [14-287]  PS50893 [367-556]  PS50893
PS50893   ABC_TRANSPORTER_2
 [53-202]  8.3e-16 PF00005 [408-514]  1.3e-15 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [38-247]  4.60000044330862e-15 SM00382 [393-557]  2.19999900980708e-12 SM00382
SM00382   AAA
IPR007406 Prokaryotic chromosome segregation/condensation protein MukB, N-terminal (Domain)
 [391-555]  1e-67 G3DSA:3.40.1140.10
G3DSA:3.40.1140.10   Scp_MukB_N
IPR017871 ABC transporter, conserved site (Conserved_site)
 [174-188]  PS00211 [486-500]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-24]  0.149 Signal
Eukaryota   
 [1-38]  0.221 Signal
Bacteria, Gram-negative   
TMHMM No significant hit